Bioquímicos e reagentes

<p>Purified recombinant DYNLT3 protein (His tag)</p>

<p>DSG3 antibody is a monoclonal antibody used in the field of Life Sciences as an important tool for research and development. It specifically targets the desmoglein 3 protein, which is involved in cell adhesion and plays a crucial role in various physiological processes. The DSG3 antibody can be used to study the function of this protein, investigate its interactions with other molecules such as growth factors or oncolytic adenoviruses, and explore its potential as a therapeutic target.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XIRP2 antibody, catalog no. 70R-8762</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UTP14A antibody, catalog no. 70R-4460</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RABEPK antibody, catalog no. 70R-4503</p>

<p>Purified Polyclonal IGF1 Receptor antibody</p>

<p>SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN</p>

<p>GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF6 antibody, catalog no. 70R-3063</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHAG antibody, catalog no. 70R-1913</p>

<p>CD29 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rat monoclonal CD122 antibody (PE)</p>

<p>Goat anti-monkey IgG (FITC) was raised in goat using monkey IgG as the immunogen.</p>

<p>Mouse monoclonal CD154 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal GLU2B antibody</p>

<p>LEPREL1 antibody was raised in Rabbit using Human LEPREL1 as the immunogen</p>

<p>POLDIP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES</p>

<p>The Claudin 2 antibody is a highly specific and potent test substance used in various research applications. It is commonly used in polymerase chain reactions (PCR) to detect the presence of autoantibodies, particularly in MDA-MB-231 cells. This antibody is also widely used in the field of life sciences to study the function and structure of cardiomyocytes.</p>

<p>The SIRT5 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and recognizes SIRT5, a protein involved in various cellular processes. This monoclonal antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>HMG20A antibody was raised in Rabbit using Human HMG20A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-217H1.1 antibody, catalog no. 70R-7508</p>

<p>CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids RIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPL</p>

<p>ATG16L1 antibody was raised in Rabbit using Human ATG16L1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that belongs to the class of rifamycins. It is specifically designed to treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its effectiveness has been demonstrated through rigorous testing using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal UGCGL1 antibody</p>

<p>Goat anti-rabbit IgG (Rhodamine) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>ML291 is a chemical compound that functions as an investigative antimicrobial agent, which is synthesized through intricate organic chemistry processes to yield a distinct molecular structure. Its mode of action involves disrupting bacterial metabolic pathways, leading to the inhibition of essential enzymatic functions. By targeting specific cellular processes, ML291 effectively impedes the growth of various bacterial strains.</p>

<p>Affinity purified Rabbit polyclonal Prohibitin 2 antibody</p>

<p>ABI1 antibody was raised in Rabbit using Human ABI1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN2 antibody, catalog no. 70R-7314</p>

<p>The gamma Tubulin antibody is a powerful tool used in Life Sciences research. It is a mouse monoclonal antibody that specifically targets gamma Tubulin, a protein involved in the organization of microtubules and centrosome function. This antibody has been extensively validated for use in various applications, including immunofluorescence, immunohistochemistry, and western blotting.</p>

<p>ST6GALNAC3 antibody was raised using the C terminal of ST6GALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT</p>

<p>Rabbit polyclonal ZIC1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits bactericidal activity against mycobacterium strains. It achieves this by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The CD62P antibody is a monoclonal antibody that acts as an inhibitor. It has been shown to prevent hemolysis and inhibit the growth factor in adipose tissue. Additionally, this antibody has demonstrated potential in reducing amyloid plaque formation and targeting activated proteins. It also exhibits cytotoxic effects on Mycoplasma genitalium. The CD62P antibody belongs to the group of Monoclonal Antibodies and is effective against autoantibodies, particularly those targeting annexin.</p>

<p>PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI</p>

<p>NXNL2 antibody was raised using the middle region of NXNL2 corresponding to a region with amino acids SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC</p>

<p>SPA17 antibody was raised in rabbit using the N terminal of SPA17 as the immunogen</p>

<p>Purified Rabbit polyclonal OXER1 antibody</p>

<p>Affinity purified Rabbit polyclonal TEAD4 antibody</p>

<p>The SERPINA1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes the activity of SERPINA1, an important protein involved in adipose tissue regulation. This antibody has been shown to have cytotoxic effects on adipocytes, leading to a reduction in adipose tissue mass. Additionally, it has been found to modulate the levels of various hormones such as androgen, dopamine, glucagon, and growth factors. The SERPINA1 antibody is a valuable tool for researchers studying the molecular mechanisms underlying adipose tissue function and regulation. With its high specificity and potency, this monoclonal antibody offers great potential for therapeutic applications in the future.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB8 antibody, catalog no. 70R-6177</p>

<p>The PAK2 antibody is a monoclonal antibody that has antiviral properties. It specifically targets and binds to PAK2, a protein involved in various cellular processes such as cell migration, proliferation, and survival. This antibody can be used for research purposes in the field of Life Sciences to study the role of PAK2 in different biological pathways.</p>

<p>MGAT4C antibody was raised in Rabbit using Human MGAT4C as the immunogen</p>

<p>Rabbit Polyclonal SHP2 antibody (Tyr542)</p>

<p>The CXCR3 antibody is a monoclonal antibody that targets the CXCR3 chemokine receptor, a crucial molecule involved in cell growth and migration. This antibody is widely used in Life Sciences research to study the role of CXCR3 in various biological processes. It has been shown to be effective in neutralizing the activity of CXCR3 and blocking its interaction with its ligands. The CXCR3 antibody has also been used in studies on pleomorphic adenoma, where it was found to inhibit the collagenase activity of this tumor. This monoclonal antibody is available as both a test substance and for research purposes. It can be conjugated with magnetic particles for easy purification or detection. Whether you are studying chemokine signaling or investigating the function of CXCR3, this antibody is an essential tool for your research.</p>

<p>SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA</p>

<p>SRA1 antibody was raised in rabbit using the middle region of SRA1 as the immunogen</p>

<p>Rabbit anti-cat IgG (Rhodamine) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>UNCX antibody was raised in rabbit using the C terminal of UNCX as the immunogen</p>

<p>EPS8 antibody was raised using the middle region of EPS8 corresponding to a region with amino acids VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH</p>

<p>The BMX antibody is a powerful tool for researchers in the field of molecular biology. It is an antibody that specifically targets and binds to the BMX protein, a member of the tyrosine kinase family. This antibody can be used in various applications, such as Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>CLDN11 antibody was raised in Rabbit using Human CLDN11 as the immunogen</p>

<p>Rabbit polyclonal Cyclin D3 antibody (Thr283)</p>

<p>Mouse monoclonal Influenza A H1N1 HA1 antibody</p>

<p>Rabbit polyclonal MSK1 antibody (Ser360)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DNASE2B antibody, catalog no. 70R-1554</p>

<p>ZNF549 antibody was raised in rabbit using the middle region of ZNF549 as the immunogen</p>

<p>BLK antibody was raised in Mouse using a purified recombinant fragment of BLK expressed in E. coli as the immunogen.</p>

<p>GFAP antibody was raised in Rabbit using Human GFAP as the immunogen</p>

<p>GCP2 antibody was raised in rabbit using highly pure recombinant human GCP-2 as the immunogen.</p>

<p>Rabbit polyclonal AGP2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC285033 antibody, catalog no. 70R-3365</p>

<p>ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV</p>

ERCC8 antibody was raised using the middle region of ERCC8 corresponding to a region with amino acids FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE

<p>UBE2N antibody was raised using a synthetic peptide corresponding to a region with amino acids GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE</p>

<p>The Calmodulin antibody is a biomolecule that acts as a growth factor and is used in various research applications. This monoclonal antibody specifically targets calmodulin, a protein involved in intracellular signaling. The antibody can be used for immunoprecipitation, Western blotting, and immunohistochemistry experiments. It has been pegylated to improve its stability and prolong its half-life in the body. The Calmodulin antibody is also available as polyclonal antibodies for different species. These antibodies are widely used in life sciences research to study the role of calmodulin in various cellular processes. They can be used to neutralize or block the activity of calmodulin in vitro or in vivo experiments. The Calmodulin antibody is an essential tool for scientists studying signal transduction pathways, calcium signaling, and the function of calmodulin-binding proteins such as erythropoietin and natriuretic peptides. With its high specificity and sensitivity, this antibody ensures accurate and</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNK3 antibody, catalog no. 70R-5768</p>

<p>The DR3 antibody is a highly specialized monoclonal antibody that has been developed for its ability to target and neutralize the DR3 receptor. This receptor plays a crucial role in the immune response, specifically in the activation of T cells and the production of interferon. By binding to the DR3 receptor, this antibody effectively blocks its activity, preventing the signaling cascade that leads to inflammation and immune system activation.</p>

<p>Rabbit polyclonal Filamin A antibody (Ser2152)</p>

<p>The Peptide YY antibody is a highly specialized antibody used in the field of Life Sciences. It plays a crucial role in regulating pancreatic insulin secretion and is commonly used in research and medical applications. This antibody can be employed through various techniques such as microinjection or colloid-based delivery systems to study the effects of Peptide YY on insulin production and release. Additionally, it can be used to investigate the therapeutic potential of Peptide YY as a treatment for diabetes and other metabolic disorders. The Peptide YY antibody is a valuable tool for scientists and researchers in the field of medicine who are interested in studying the intricate mechanisms involved in insulin regulation and exploring potential therapeutic interventions. With its high specificity and stability, this monoclonal antibody ensures accurate and reliable results even at subthreshold doses.</p>

<p>Purified Polyclonal MRP7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SAE1 antibody, catalog no. 70R-3589</p>

<p>Purified Polyclonal Alpha sarcoglycan antibody</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>EFHD2 antibody was raised in Rabbit using Human EFHD2 as the immunogen</p>

<p>Influenza A antibody (H3N2) (FITC) was raised in goat using Influenza A, strain Texas 1/77 (H3N2) as the immunogen.</p>

<p>Rabbit polyclonal NFKP p100/p52 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTA1 antibody, catalog no. 70R-10211</p>

<p>Isorauhimbin is an indole alkaloid, which is derived from the plant family Apocynaceae. It is primarily sourced from the bark of Rauwolfia plants, where it exists as one of the stereoisomers of yohimbine. The mode of action of Isorauhimbin involves its interaction with adrenergic receptors, specifically acting as an antagonist at the alpha-2 adrenergic receptors. This interaction results in increased release of norepinephrine and enhanced sympathetic nervous system activity.</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL27 antibody, catalog no. 70R-10164</p>

<p>Rabbit polyclonal VEGFR1 antibody (Tyr1048)</p>

<p>GDF5 protein containing region of amino acids corresponding to: APSATRQGKR PSKNLKARCS RKALHVNFKD MGWDDWIIAP LEYEAFHCEG LCEFPLRSHL EPTNHAVIQT LMNSMDPEST PPTCCVPTRL SPISILFIDS ANNVVYKQYE DMVVESCGCR.</p>

<p>C2orf60 antibody was raised in rabbit using the middle region of C2ORF60 as the immunogen</p>

<p>The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically detect and bind to phosphotyrosine residues, which are important markers of activated signaling pathways. This antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.</p>

<p>Rabbit polyclonal CXCL1 antibody (biotin)</p>

<p>Mouse monoclonal ANKRD53 antibody</p>

<p>Rabbit polyclonal SDP3 antibody (biotin)</p>

<p>KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF</p>

<p>Mouse monoclonal THRA antibody (a2-Isotype)</p>

<p>IL2Ra antibody was raised in mouse using recombinant human soluble IL-2 Receptor alpha as the immunogen.</p>

<p>The Cytochrome P450 2D6 antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism, particularly in the metabolism of drugs that are commonly used in neurological and psychiatric disorders.</p>

<p>AKR1B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI</p>

<p>VISA antibody was raised using the N terminal of VISA corresponding to a region with amino acids ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH</p>

Purified recombinant CD27 protein (His tag)

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAF7 antibody, catalog no. 70R-5931</p>

<p>Rabbit polyclonal CEBP epsilon antibody (Thr74)</p>