Bioquímicos e reagentes

<p>Purified recombinant MRPL1 protein (His tag)</p>

<p>Mouse monoclonal RPN10 antibody</p>

<p>Mouse monoclonal CST3 antibody</p>

<p>Purified recombinant CXADR protein (His tag)</p>

<p>Sheep polyclonal Bovine Transferrin antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPD1 antibody, catalog no. 70R-3143</p>

<p>Keratin K2 antibody was raised in mouse using Keratin K2 as the immunogen.</p>

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) in human serum. It can be used in various applications, including research in Life Sciences and diagnostics. This antibody binds to AFP, a glycoprotein that is normally produced by the liver during fetal development but can also be present in certain types of cancer, such as hepatocellular carcinoma and germ cell tumors.</p>

<p>Mouse monoclonal GBP5 antibody</p>

<p>Rabbit polyclonal SMTNL2 antibody</p>

<p>Rabbit polyclonal CPN1 antibody</p>

Mouse IgG1 antibody was raised in goat using mouse IgG1 in freunds adjuvant as the immunogen.

<p>MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM</p>

<p>Mouse monoclonal LDH Pan antibody</p>

<p>ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE</p>

<p>Sterile Rabbit Plasma with EDTA</p>

<p>ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE</p>

Rabbit polyclonal AEG1 antibody

<p>Purified recombinant Human SERTAD1 protein (His tag)</p>

<p>ZNF529 antibody was raised in rabbit using the middle region of ZNF529 as the immunogen</p>

<p>Purified recombinant Human CD83 protein (His tag)</p>

<p>Lymphotoxin alpha antibody is a highly specialized medicament used in Life Sciences research. It is an inhibitor that targets adeno-associated virus and plays a crucial role in pluripotent stem cells. This antibody has been extensively used in assays to study the effects of test compounds on interleukin production. Lymphotoxin alpha antibody possesses high affinity for its ligands and has been employed in the isolation of autoantibodies and extracellular markers. Its unique properties make it an indispensable tool for researchers studying various biological processes, including those related to the retina.</p>

<p>Rabbit polyclonal UMOD antibody</p>

COPS7A antibody was raised using a synthetic peptide corresponding to a region with amino acids NLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGL

<p>The SOX5 antibody is a monoclonal antibody that targets the catechol-O-methyltransferase (COMT) enzyme. It is widely used in Life Sciences research as a biomolecule for various applications. This antibody specifically recognizes and binds to the activated form of COMT, inhibiting its enzymatic activity. By neutralizing COMT, the SOX5 antibody modulates dopamine levels, which plays a crucial role in several physiological processes.</p>

<p>ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM</p>

<p>Mouse monoclonal DCXR antibody</p>

<p>Purified Polyclonal MED22 antibody</p>

<p>GABA A Receptor alpha-1 antibody was raised in mouse using purified GABA/benzodiazepine receptor from bovine cortex as the immunogen.</p>

<p>The Keratin 18 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic and neutralizing properties. It is commonly used in Life Sciences research to study the role of keratin 18 in various cellular processes. This antibody specifically targets keratin 18, a type of intermediate filament protein found in epithelial cells.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It effectively treats tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>P2RX7 antibody was raised using the middle region of P2RX7 corresponding to a region with amino acids LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP</p>

<p>ZNF454 antibody was raised in rabbit using the N terminal of ZNF454 as the immunogen</p>

FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN

<p>Purified recombinant MAGOHB protein (His tag)</p>

<p>HtrA2/Omi antibody was raised in mouse using recombinant human HtrA2/Omi (134-458aa) purified from E. Coli as the immunogen.</p>

<p>The Cytokeratin 8 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the virus surface antigen and has been shown to have cytotoxic effects on infected cells. Additionally, this antibody has interferon-neutralizing properties, making it a valuable tool for studying the immune response to viral infections. The Cytokeratin 8 antibody is produced using advanced techniques and is available in both monoclonal and polyclonal forms. It is supplied in a buffered solution to ensure stability and can be activated for use in various applications, including immunohistochemistry and flow cytometry. With its high specificity and strong antigen-antibody reaction, the Cytokeratin 8 antibody is an essential tool for researchers studying viral pathogenesis and host immune responses.</p>

<p>The CTNNB1 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the CTNNB1 protein, also known as beta-catenin, which plays a crucial role in cell adhesion and signaling pathways. This antibody is produced using advanced techniques and has been extensively validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal OSBPL11 antibody</p>

<p>The ACAT1 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It targets and interacts with the acetyltransferase enzyme, which plays a crucial role in various cellular processes. This antibody has been shown to have significant effects on insulin signaling pathways and β-catenin regulation.</p>

<p>ATP5G2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA</p>

<p>IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE</p>

<p>Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF</p>

<p>The SUOX antibody is a monoclonal antibody that has various characteristics and applications. It is primarily used as a diuretic and immunosuppressant in the field of medicine. This antibody targets adipose tissue and inhibits the activity of 3-kinase, which plays a role in fat metabolism. By doing so, it promotes weight loss and helps regulate body composition.</p>

<p>ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT</p>

<p>Rabbit polyclonal SNRPD3 antibody</p>

<p>Purified recombinant CDKN1A protein (His tag)</p>

<p>GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK</p>

<p>IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV</p>

<p>Rabbit polyclonal SEPARASE antibody (Ser801)</p>

<p>SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG</p>

<p>The PAR1 antibody is a highly specialized immunohistochemistry tool used in Life Sciences research. It is an adeno-associated virus (AAV)-based vector that delivers specific antibodies to target cells. The PAR1 antibody specifically targets the protease-activated receptor 1 (PAR1) and inhibits its activation by blocking the binding of thrombin, the main activator of PAR1. This monoclonal antibody is designed to neutralize PAR1 activity and has been proven effective in various studies.</p>

<p>The STAT1 antibody is a monoclonal antibody that specifically targets the STAT1 protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and immune response. The STAT1 antibody binds to the STAT1 protein, preventing its activation and subsequent signaling cascade. This inhibition can have significant effects on cell function and can be used in various research applications in the life sciences field. Whether you are studying cell signaling pathways or investigating the role of STAT1 in disease development, this monoclonal antibody is an invaluable tool. With its high specificity and affinity for the target protein, the STAT1 antibody ensures accurate and reliable results in your experiments. Trust this antibody to provide you with the precise data you need for your research endeavors.</p>

<p>Mouse monoclonal LENG1 antibody</p>

<p>Purified recombinant TTC32 protein (His tag)</p>

<p>PNMA3 antibody was raised using the middle region of PNMA3 corresponding to a region with amino acids RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target tuberculosis infection and contains active compounds known for their potent bactericidal activity. The key mechanism of action involves binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes, confirming its high efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also exhibits specific binding to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The Tau antibody is a highly specialized antibody that targets and interacts with the protein tau. Tau is involved in various cellular processes, including the stabilization of microtubules. This antibody has been extensively studied for its potential role in neurodegenerative diseases like Alzheimer's disease.</p>

<p>Horse RBC antibody (Texas Red) was raised in rabbit using equine erythrocytes as the immunogen.</p>

<p>TUBD1 antibody was raised in mouse using recombinant Human Tubulin, Delta 1 (Tubd1)</p>

<p>Rabbit polyclonal THBS3 antibody</p>

<p>Purified Parainfluenza type 2 protein</p>

<p>The HSP25 antibody is a monoclonal antibody that specifically targets the antigen HSP25. This antibody is widely used in the field of life sciences for various applications, including research and diagnostics. The HSP25 antibody can be used to detect and quantify the levels of HSP25 in different samples, such as human serum or cell lysates. It can also be used in immunohistochemistry and immunofluorescence experiments to visualize the localization of HSP25 within cells or tissues. Additionally, this antibody has been utilized in studies investigating the role of HSP25 in various biological processes, such as its interaction with TGF-beta signaling pathways or its involvement in helicobacter infections. With its high specificity and sensitivity, the HSP25 antibody is an essential tool for researchers studying protein-protein interactions or exploring potential therapeutic targets.</p>

<p>Rabbit polyclonal TOM70 antibody</p>

<p>Recombinant Human CHST10 protein (His tag)</p>

<p>RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL</p>

<p>LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV</p>

<p>CCNF antibody was raised in mouse using recombinant Human Cyclin F (Ccnf)</p>

<p>RANKL antibody was raised in goat using highly pure recombinant human sRANKL as the immunogen.</p>

<p>The CBL antibody is a highly specialized antibody used in the field of life sciences. It is a polyclonal antibody that targets dopamine and progesterone, among other molecules. This antibody has the unique ability to neutralize these substances, making it an essential tool for research and experimentation. The CBL antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. Its high specificity and sensitivity ensure accurate and reliable results. Whether you are studying activated adipose cells or investigating the role of chemokines in disease progression, the CBL antibody is an indispensable tool in your research arsenal. Order yours today and unlock new insights in your scientific endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V0E2 antibody, catalog no. 70R-2843</p>

STEAP1 antibody was raised in mouse using recombinant human STEAP1 (1-70aa) purified from E. coli as the immunogen.

<p>Rabbit polyclonal PLCB2 antibody</p>

<p>Purified native Human PAP protein</p>

Alpha 2 macroglobulin antibody was raised in mouse using human serum alpha-2 macroglobulin as the immunogen.

<p>Rabbit polyclonal RBP4 antibody (FITC)</p>

<p>Rabbit polyclonal TRKB antibody (Tyr705)</p>

<p>CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST</p>

<p>Purified recombinant Human OBFC1 protein (His tag)</p>

<p>SLC9A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI</p>

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

CKMM antibody was raised in mouse using purified human CKMM as the immunogen.

<p>Trichomonas vaginalis antibody was raised in mouse using Trichomonas Vaginalis as the immunogen.</p>

<p>Purified native Porcine Haptoglobin protein</p>

<p>Rabbit polyclonal HSD11B1 antibody</p>

<p>Rabbit polyclonal RAP2B antibody</p>

<p>CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE</p>

<p>Purified Polyclonal Kanadaptin antibody</p>

<p>ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG</p>

<p>Rabbit polyclonal TLE1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gm13178 antibody, catalog no. 70R-8604</p>

<p>Purified Rabbit polyclonal BCLXL antibody (Ser62)</p>

<p>Purified recombinant MOB1B protein (His tag)</p>

<p>The Ly6G antibody is a trifunctional monoclonal antibody that is widely used in the field of Life Sciences. It is commonly used for research purposes, specifically in the detection and analysis of various proteins and molecules. This antibody has phosphatase activity, making it a valuable tool for studying signal transduction pathways.</p>

<p>The CD86 antibody is a monoclonal antibody that is widely used in life sciences research. This antibody specifically targets the CD86 antigen, which is expressed on the surface of various immune cells. The CD86 antibody can be used for a variety of applications, including immunohistochemistry, flow cytometry, and Western blotting. It has been shown to have neutralizing activity against the CD86 antigen and can inhibit its interaction with other molecules involved in immune response regulation. Additionally, this antibody has been found to have potential therapeutic applications, particularly in the treatment of inflammatory diseases and cancer. With its high specificity and versatility, the CD86 antibody is an essential tool for researchers in the field of immunology and beyond.</p>

<p>Rabbit polyclonal GPR143 antibody</p>

<p>OLIG3 antibody was raised in rabbit using the N terminal of OLIG3 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy through patch-clamp technique analysis on human erythrocytes.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>