Bioquímicos e reagentes

<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>

<p>Rat Plasminogen ELISA Kit</p>

<p>FSH ELISA kit for the quantitative measurement of FSH in human serum</p>

<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>

<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>ELISA kit for detection of Human IL10 in the research laboratory</p>

<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>

<p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>