Bioquímicos e reagentes

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>Please enquire for more information about Mouse IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>

<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Hamster (CHO) Legumain ELISA Kit<br> <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>

<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>Bovine Transferrin ELISA Kit</p>

<p>Chicken IgA ELISA Kit</p>

<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>

<p>(R)-DPN is a selective agonist, which is a chemical compound primarily sourced through synthetic organic chemistry techniques. Its mode of action involves specifically binding to and activating the estrogen-related receptor gamma (ERRγ), a member of the nuclear receptor superfamily. By acting as a highly selective ligand, (R)-DPN modulates the transcriptional activity associated with the ERRγ receptor, influencing various biological pathways.</p>

<p>Ready to use Mouse C1q ELISA Kit</p>

<p>Please enquire for more information about Mouse Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Canine/Dog SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in dog samples.</p>

<p>Plasminogen is a protein that plays a crucial role in the blood clotting process. It is produced by the liver and circulates in the blood. Plasminogen is inactive in its native form, but it can be converted into its active form, called plasmin, through a process known as fibrinolysis.<br>Fibrinolysis is the body's natural mechanism to dissolve blood clots. When a blood clot forms, plasminogen binds to it. Activators, such as tissue plasminogen activator (tPA), trigger the conversion of plasminogen into plasmin. Plasmin then breaks down the fibrin mesh of the blood clot, leading to its dissolution.<br>This process is important for maintaining proper blood flow and preventing excessive clot formation. Plasminogen and the fibrinolysis pathway are essential components of the body's hemostatic (blood clotting) and thrombolytic (clot dissolution) systems.</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.</p>

<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse Myoglobin ELISA Kit</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>

<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>

<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PQR626 is a human analog of astaxanthin, a carotenoid with strong antioxidant properties. It has been shown to have anti-cancer effects by inhibiting the activity of trypsin-like proteases and kinases involved in tumor cell growth and survival. PQR626 induces apoptosis in cancer cells and has been investigated as a potential treatment for various types of cancer, including Chinese hamster ovary cells and prostate cancer. This compound also shows promise as an inhibitor of rifampicin-induced urinary excretion, which may increase the bioavailability of other drugs.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>

<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>Phevamine A is a peptide inhibitor that binds to the β2 adrenergic receptor and blocks the activation of this receptor by its ligands. Phevamine A also has an agonistic effect on G-protein coupled receptors, including the β1 adrenergic receptor. This drug is used in research as a tool to study protein interactions, activator or inhibitor of protein function, and as a high purity reagent for life science applications.</p>

<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>

<p>Mouse Fetuin/AHSG ELISA Kit.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>Guinea Pig C3 ELISA Kit</p>

<p>PF 04217903 mesylate is a factor receptor inhibitor that inhibits the transcription of insulin-like growth factor and epidermal growth factor. It is used in the treatment of neoplastic disease, such as breast cancer, ovarian cancer, and prostate cancer. PF 04217903 mesylate also inhibits angiogenesis by inhibiting the expression of transcription factors that are involved in this process. These effects may be due to its ability to inhibit the production of erythropoietin and other proangiogenic molecules. PF 04217903 mesylate has been shown to inhibit the proliferation of vascular endothelial cells in vitro and in vivo.</p>

<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of P-Selectin in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>

<p>Please enquire for more information about Dog IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>ELISA kit for the detection of IGFBP1 in the research laboratory</p>

<p>ELISA kit for detection of MMP1 in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>

<p>Purified native Porcine Porcine Liver Esterase protein</p>

<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>

<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>

<p>ELISA Kit for detection of TARC in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF6 antibody, catalog no. 70R-1449</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>ELISA kit for detection of TrkA in the research laboratory</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>AMBMP Hydrochloride is a synthetic compound, specifically designed for research purposes in the field of neuroscience. This compound is derived from a series of carefully crafted chemical reactions, typically originating from a laboratory setting specializing in organic synthesis. Its primary mode of action is as a selective ligand targeting specific receptors within the central nervous system, allowing researchers to investigate receptor function and signaling pathways with precision.</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>

<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>

<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>

<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>ELISA kit for the detection of Human Bax in the research laboratory</p>

<p>C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH</p>

<p>ELISA kit for detection of IL18 in the research laboratory</p>

<p>ELISA kit for the detection of CA 199 in the research laboratory</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>ELISA Kit for detection of MDC in the research laboratory</p>

<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>ELISA kit for the detection of PTH intact in the research laboratory</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>ELISA kit for the detection of AFP in the research laboratory</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgM in the research laboratory</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>

<p>ELISA Kit for detection of Estradiol antibody in the research laboratory</p>

<p>Recombinant Human ARFIP1 protein</p>

<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>

<p>ELISA kit for detection of VCAM1 in the research laboratory</p>

<p>ELISA kit for detection of IGF2 in the research laboratory</p>

<p>ELISA kit for detection of Progesterone in the research laboratory</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA kit for the detection of Rat CRP in the research laboratory</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>ELISA kit for detection of TIMP2 in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA kit for the detection of Triiodothyronine Uptake in the research laboratory</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>ELISA kit for the detection of SSB in the research laboratory</p>

<p>ELISA kit for the detection of ssDNA in the research laboratory</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>ELISA kit for the detection of MCP1 in the research laboratory</p>

<p>Antagonist of histamine receptor H4</p>

<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>ELISA Kit for detection of Leukotriene B4 in the research laboratory</p>

<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA kit for detection of PSA in the research laboratory</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>

<p>ELISA kit for detection of OPN in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>ELISA kit for detection of EGF in the research laboratory</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>(R)-Funapide is a ligand that binds to the activator site of the nicotinic acetylcholine receptor (nAChR) and has been shown to activate this receptor. It is used as a research tool in cell biology, ion channels, peptides, and antibodies. (R)-Funapide has also been shown to inhibit protein interactions with a number of different receptors.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>ELISA Kit for detection of TPO in the research laboratory</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of &gt; 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>

<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory</p>

<p>D-Threonic acid lithium salt is a cell signaling molecule that belongs to the class of ligands. It has been used as a research tool in pharmacology and protein interaction studies. D-Threonic acid lithium salt can activate ion channels, which are cellular membrane proteins that allow ions to flow in or out of cells. D-Threonic acid lithium salt also interacts with receptors, which are proteins on the surface of cells that receive chemical signals from outside the cells. Receptors can be either agonists or antagonists. D-Threonic acid lithium salt is a ligand for receptor tyrosine kinase, which is involved in cell growth and differentiation.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>