Bioquímicos e reagentes

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IgY, or immunoglobulin Y, is a type of antibody found in the immune systems of birds, reptiles, and amphibians. It serves a similar function to IgG in mammals. In birds, IgY is the primary antibody found in serum, egg yolk, and other bodily fluids, whereas in mammals, IgG is the predominant antibody. IgY antibodies are important for providing passive immunity to offspring through the transfer of antibodies from the mother to the egg yolk, similar to how mammals transfer antibodies through the placenta or breast milk. IgY antibodies have also been used in research and diagnostic applications due to their specificity and ability to be harvested from egg yolks.</p>

<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>

<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>

<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>

<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>

<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>

<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>

<p>Rat Osteopontin ELISA Kit</p>

<p>For the quantitative determination of canine/dog albumin in biological samples.</p>

<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>Rabbit IgA ELISA Kit</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>ELISA kit for detection of IGFBP1 in the research laboratory</p>

<p>Quantify pig albumin in your samples.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>ELISA kit for detection of Human IL8 in the research laboratory</p>

<p>Horse IgA ELISA Kit</p>

<p>Bovine/Cow AGP ELISA Kit</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>

<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>

<p>ELISA kit for the detection of SSA  in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>Sheep Haptoglobin ELISA Kit;</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>Rat Fatty Acid Binding Protein ELISA Kit</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>Purified recombinant LGALS1 protein (His tag)</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human Myoglobin ELISA Kit</p>

<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>

<p>Human NGAL ELISA Kit</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>A reliable ELISA Kit for quantifying soluble interleukin-2 receptor (sIL-2R, sIL2R, sTAC, sCD25) in dog serum/plasma samples.</p>

<p>Human HMGB1(High mobility group protein B1) ELISA Kit</p>

<p>Cat Haptoglobin ELISA Kit</p>

<p>Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.</p>

<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of BAFF in the research laboratory</p>

<p>Pig IgA ELISA Kit</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>

<p>Goat anti Human IgE antibody</p>

<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>

<p>Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5171</p>

<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>For the quantitative determination of chicken immunoglobulin M (IgM) in biological samples.;</p>

<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>

<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Human Fetuin/AHSG ELISA Kit</p>

<p>Rat Antithrombin III ELISA Kit</p>

<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Cat IgM ELISA Kit</p>

<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of Human IL4 in the research laboratory</p>

<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>

<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>

<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>

<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Rabbit Plasminogen ELISA Kit</p>

<p>ELISA kit for detection of MMP1 in the research laboratory</p>

<p>Monkey Cystatin C ELISA Kit</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>Bovine IL-6 ELISA Kit</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Rat Prealbumin (TTR) ELISA Kit</p>

<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Guinea Pig C3 ELISA Kit</p>

<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>

<p>Dog Transferrin ELISA Kit</p>

<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of IL25 in the research laboratory</p>

<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of GBM in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>Guinea Pig IgA ELISA Kit</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Pig Plasminogen ELISA Kit</p>

<p>Horse CRP ELISA Kit</p>

<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>

<p>Rat IgM ELISA Kit</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>Recombinant Mouse MASP2 protein</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>Please enquire for more information about Dog IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Human sequence expressed in sf Insect Cells; purity &gt;97% by SDS-PAGE and analyzed by silver stain.</p>

<p>Purified recombinant FBXO6 protein (His tag)</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>Please enquire for more information about Human Hemopexin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>

<p>ELISA kit for the detection of PR3  in the research laboratory</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>Human Kappa ELISA Kit</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.<br>Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.</p>

<p>ELISA kit for the detection of Lactoferrin in the research laboratory</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgM in the research laboratory</p>

<p>Please enquire for more information about Rat AGP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Mouse Retinol Binding Protein ELISA Kit</p>

<p>ELISA kit for detection of RBP4 in the research laboratory</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>