Bioquímicos e reagentes

<p>Phevamine A is a peptide inhibitor that binds to the β2 adrenergic receptor and blocks the activation of this receptor by its ligands. Phevamine A also has an agonistic effect on G-protein coupled receptors, including the β1 adrenergic receptor. This drug is used in research as a tool to study protein interactions, activator or inhibitor of protein function, and as a high purity reagent for life science applications.</p>

<p>5-Methyl cromolyn sodium is a potent inhibitor of the release of histamine and leukotrienes from mast cells and basophils. It is used to prevent allergic reactions because it blocks the activation of these cells. Cromolyn sodium has also been shown to be an effective treatment for asthma, chronic obstructive pulmonary disease (COPD), and other respiratory diseases. 5-Methyl cromolyn sodium has been shown to inhibit ion channels, which may lead to its antihistamine activity. This drug has been shown to bind with high affinity to a number of receptor ligands including peptides, antibodies, and cell biology proteins.</p>

<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>

<p>Mouse TNF-alpha ELISA Kit</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Purified recombinant IYD protein (His tag)</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>Purified recombinant Human DECR1 protein</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>

<p>ELISA kit for the detection of ssDNA in the research laboratory</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>

<p>Recombinant Human ARFIP1 protein</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>

<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>

<p>ELISA kit for the detection of Triiodothyronine Uptake in the research laboratory</p>

<p>(R)-DPN is a selective agonist, which is a chemical compound primarily sourced through synthetic organic chemistry techniques. Its mode of action involves specifically binding to and activating the estrogen-related receptor gamma (ERRγ), a member of the nuclear receptor superfamily. By acting as a highly selective ligand, (R)-DPN modulates the transcriptional activity associated with the ERRγ receptor, influencing various biological pathways.</p>

<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>ELISA kit for detection of VCAM1 in the research laboratory</p>

<p>ELISA kit for detection of IGF2 in the research laboratory</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. NGAL binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients with urinary tract infections. Additionally, NGAL has been shown to be associated with neurological diseases, such as Alzheimer's disease and Parkinson's disease. The recombinant human form of this protein can be used for research purposes or for the development of diagnostic tools. Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. It binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients</p>

<p>Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOPL antibody, catalog no. 70R-8870</p>

<p>ELISA kit for the detection of Dengue Virus IgM in the research laboratory</p>

<p>Mouse Hemopexin ELISA Kit</p>

<p>Human IgD ELISA Kit</p>

<p>Dog C3 ELISA Kit</p>

<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>

<p>Quantify total bovine IgA in your samples.</p>

<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>

<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>

<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>

<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>Rat Prealbumin (TTR) ELISA Kit</p>

<p>Mouse Myoglobin ELISA Kit</p>

<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Plasminogen is a protein that plays a crucial role in the blood clotting process. It is produced by the liver and circulates in the blood. Plasminogen is inactive in its native form, but it can be converted into its active form, called plasmin, through a process known as fibrinolysis.<br>Fibrinolysis is the body's natural mechanism to dissolve blood clots. When a blood clot forms, plasminogen binds to it. Activators, such as tissue plasminogen activator (tPA), trigger the conversion of plasminogen into plasmin. Plasmin then breaks down the fibrin mesh of the blood clot, leading to its dissolution.<br>This process is important for maintaining proper blood flow and preventing excessive clot formation. Plasminogen and the fibrinolysis pathway are essential components of the body's hemostatic (blood clotting) and thrombolytic (clot dissolution) systems.</p>

<p>Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.</p>

<p>Horse SAA ELISA Kit</p>

<p>Bovine SAA ELISA Kit</p>

<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Guinea Pig IgM ELISA Kit</p>

<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>1. Activates TRPV1 receptor, which is involved in the transmission of pain signals and the release of inflammatory mediators<br>2. Binds to and activates P2X7 receptors, which are associated with cell death and inflammation<br>3. Blocks voltage-gated calcium channels, which play a role in neuronal excitability and muscle contraction<br>4. Inhibits the activity of MAP kinase phosphatases, which are involved in regulating the activation of MAP kinase <br>5. Stimulates ligand-gated ion channels such as nicotinic acetylcholine receptors (nAChRs) <br>6. Binds to GABA receptors, inhibiting the effects of GABA on neurons <br>7. Acts as an antagonist at dopamine D2 receptors <br>8. Binds to muscarinic M1/M3 receptors, inhibiting acetylcholine release <br>9. Binds to alpha-adrenergic receptors, leading to vas</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>ELISA kit for detection of CMV in the research laboratory</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>

<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pig IgM ELISA Kit</p>

<p>Rabbit IgM ELISA Kit</p>

<p>Mouse IgG ELISA Kit - For the quantitative determination of total mouse IgG in biological samples that may contain bovine,horse or human proteins immunoglobulins.</p>

<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>

<p>Hamster (CHO) Legumain ELISA Kit<br> <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>

<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>Monkey Cystatin C ELISA Kit</p>

<p>Quantify pig albumin in your samples.</p>

<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>

<p>FSH ELISA kit for the quantitative measurement of FSH in human serum</p>

<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>

<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>

<p>Rabbit IgA ELISA Kit</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>Rat Fatty Acid Binding Protein ELISA Kit</p>

<p>ELISA kit for detection of Human IL6 in the research laboratory</p>

<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>

<p>ELISA kit for detection of TrkA in the research laboratory</p>

<p>ELISA kit for detection of Cystatin C in the research laboratory</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>ELISA kit for the detection of cAMP in the research laboratory</p>

<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>

<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit Plasminogen ELISA Kit</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>(R)-Funapide is a ligand that binds to the activator site of the nicotinic acetylcholine receptor (nAChR) and has been shown to activate this receptor. It is used as a research tool in cell biology, ion channels, peptides, and antibodies. (R)-Funapide has also been shown to inhibit protein interactions with a number of different receptors.</p>

<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>

<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>

<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>

<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>

<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>

<p>Sheep Haptoglobin ELISA Kit;</p>

<p>ELISA kit for the detection of IGFBP1 in the research laboratory</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat anti Human IgE antibody</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>ELISA kit for detection of PSA in the research laboratory</p>

<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>

<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>Recombinant Human POLR2K protein</p>

<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Purified recombinant FBXO6 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMOD antibody, catalog no. 70R-5310</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Catalogue peptide; min. 95% purity</p>