Bioquímicos e reagentes

<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgM in the research laboratory</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>ELISA kit for detection of Rubella in the research laboratory</p>

<p>PF 04217903 mesylate is a factor receptor inhibitor that inhibits the transcription of insulin-like growth factor and epidermal growth factor. It is used in the treatment of neoplastic disease, such as breast cancer, ovarian cancer, and prostate cancer. PF 04217903 mesylate also inhibits angiogenesis by inhibiting the expression of transcription factors that are involved in this process. These effects may be due to its ability to inhibit the production of erythropoietin and other proangiogenic molecules. PF 04217903 mesylate has been shown to inhibit the proliferation of vascular endothelial cells in vitro and in vivo.</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>Enzyme Immunoassay for the Quantitative Determination of purified M13 Bacteriophage Particles</p>

<p>ELISA kit for detection of P-Selectin in the research laboratory</p>

<p>Human IgG &amp; IgM Primer Set</p>

<p>Inhibitor of γ-secretase; Alzheimer's disease treatment</p>

<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>Purified recombinant IYD protein (His tag)</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA kit for the detection of dsDNA IgA in the research laboratory</p>

<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>Rilpivirine-d6 is a deuterated, stable isotope of rilpivirine. It is used to investigate the metabolism of drugs in plasma samples and tissues for bioequivalence studies. Rilpivirine-d6 is used as an internal standard in quantitative analysis by mass spectrometry. The stability of this molecule enables it to be used in prolonged studies without significant degradation. Rilpivirine-d6 has been shown to reduce viral load and increase CD4+ T cell counts in HIV patients who are on antiretroviral therapy. Rilpivirine-d6 binds to the reverse transcriptase enzyme and prevents the formation of DNA from RNA, thus inhibiting viral replication.</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>Inhibitor of p38 MAPK kinase</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>ELISA kit for detection of Human IL4 in the research laboratory</p>

<p>Rat Myoglobin ELISA Kit</p>

<p>(R)-Funapide is a ligand that binds to the activator site of the nicotinic acetylcholine receptor (nAChR) and has been shown to activate this receptor. It is used as a research tool in cell biology, ion channels, peptides, and antibodies. (R)-Funapide has also been shown to inhibit protein interactions with a number of different receptors.</p>

<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>

<p>Human Apolipoprotein H ELISA Kit</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>Ready to use Dog/Canine Cystatin C ELISA Kit</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>ELISA Kit for detection of AVP in the research laboratory</p>

<p>Purified native Porcine Porcine Liver Esterase protein</p>

<p>ELISA Kit for detection of CEA in the research laboratory</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>

<p>Rat Plasminogen ELISA Kit</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>Cat IgE ELISA Kit</p>

<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>Bovine Transferrin ELISA Kit</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>ELISA kit for detection of EGFR in the research laboratory</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>A reliable ELISA Kit for quantifying soluble interleukin-2 receptor (sIL-2R, sIL2R, sTAC, sCD25) in dog serum/plasma samples.</p>

<p>For the quantitative determination of chicken immunoglobulin M (IgM) in biological samples.;</p>

<p>Tiotropium bromide is a long-acting bronchodilator that is used to relieve the symptoms of asthma and chronic obstructive pulmonary disease. It is a crystalline drug with an extended duration of action. Tiotropium bromide acts by binding to the beta2-adrenergic receptor, which prevents activation of these receptors and inhibits the release of inflammatory mediators. This drug has been shown to be effective for up to 12 months in adults with asthma who are not responsive to standard therapy. Tiotropium bromide does not interact significantly with other drugs, but should be used cautiously in patients with liver impairment or congestive heart failure due to its potential for adverse effects on these organs.</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>ELISA Kit for detection of VEGF in the research laboratory</p>

<p>Rat KIM-1 ELISA Kit</p>

<p>ELISA kit for detection of OPN in the research laboratory</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>Rat GST alpha ELISA Kit</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse CRP ELISA Kit</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Human KIM-1 ELISA Kit</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>Mouse Myoglobin ELISA Kit</p>

<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Bovine Lactoferrin ELISA Kit</p>

<p>Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AMBMP Hydrochloride is a synthetic compound, specifically designed for research purposes in the field of neuroscience. This compound is derived from a series of carefully crafted chemical reactions, typically originating from a laboratory setting specializing in organic synthesis. Its primary mode of action is as a selective ligand targeting specific receptors within the central nervous system, allowing researchers to investigate receptor function and signaling pathways with precision.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Thiostatin ELISA Kit</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>

<p>Recombinant Human POLR2K protein</p>

<p>ELISA Kit for detection of TPO in the research laboratory</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>ELISA kit for detection of EGF in the research laboratory</p>

<p>Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.</p>

<p>2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine is a human analog that has been found to have anticancer properties. It acts as an inhibitor of kinases, which are enzymes involved in the regulation of cell growth and division. This compound induces apoptosis in Chinese hamster ovary cells and inhibits tumor growth in mice. 2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine has medicinal potential as a cancer therapy due to its ability to inhibit protein kinases that are involved in the development of cancer cells. This compound may be used as a therapeutic agent for various types of cancer, especially those that are resistant to conventional chemotherapy. It has also been detected in human urine, indicating its potential for use as a diagnostic tool for cancer.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>

<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>

<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>ELISA Kit for detection of IFNb in the research laboratory</p>

<p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>

<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>

<p>ELISA kit for the detection of Sm1 in the research laboratory</p>

<p>ELISA kit for the detection of SSB in the research laboratory</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>ELISA kit for the detection of Parvovirus IgG in the research laboratory</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>

<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>

<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>

<p>ELISA kit for detection of IGF2 in the research laboratory</p>

<p>ELISA kit for detection of VCAM1 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>

<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>

<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of PTH intact in the research laboratory</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>Purified Cat/Feline Haptoglobin</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>

<p>CP-724714 is a small molecule that is able to inhibit the growth of cancer cells. It has been shown to be effective against HER2+ breast cancer, colorectal carcinoma cell lines, and lung carcinoma cell lines. CP-724714 causes cell cycle arrest by inhibiting the production of proteins required for DNA replication and repair. Cell proliferation inhibition can also be achieved by blocking epidermal growth factor receptors or other growth factors such as platelet-derived growth factor (PDGF). The mechanism of action may involve interference with the activation of protein kinase B (PKB), which is involved in cell signaling pathways. CP-724714 has been studied in both cell culture and clinical studies for its biological function as a cancer therapeutic agent.</p>

<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Arabidopsis Thaliana Plant Lysate</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>PQR626 is a human analog of astaxanthin, a carotenoid with strong antioxidant properties. It has been shown to have anti-cancer effects by inhibiting the activity of trypsin-like proteases and kinases involved in tumor cell growth and survival. PQR626 induces apoptosis in cancer cells and has been investigated as a potential treatment for various types of cancer, including Chinese hamster ovary cells and prostate cancer. This compound also shows promise as an inhibitor of rifampicin-induced urinary excretion, which may increase the bioavailability of other drugs.</p>

<p>Biotin labeling kit for IgG</p>

<p>Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.<br>Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>ELISA kit for the detection of ENA in the research laboratory</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>ELISA kit for the detection of ssDNA in the research laboratory</p>