Bioquímicos e reagentes

<p>This Affinity Purified Goat anti-Mouse IgG2b antibody only reacts with the heavy chains of the IgG2b subclass. It can be used as a capture or detection antibody in a variety of immunoassays.</p>

<p>P4HB protein is a biomolecule that plays a crucial role in various biological processes. It acts as a lectin, which means it can bind to specific carbohydrate molecules. P4HB protein also has racemase activity, which allows it to convert amino acids from their L-form to their D-form. This protein is involved in cell lysis and cellulose degradation.</p>

<p>FITC Conjugate Goat anti-Dog IgG h+l Antibody. Please inquire for bulk pricing.</p>

<p>Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK</p>

<p>Purified recombinant RAPSN protein (His tag)</p>

<p>Mouse monoclonal CD3 antibody (biotin)</p>

<p>Rabbit polyclonal RPL30 antibody</p>

<p>Monoclonal Mouse anti-FLAG-Tag (TM) Antibody recognizes N-terminal, C-terminal or internal DYKDDDDK-tagged fusion proteins. Validated for use in Western Blot and ELISA assays.</p>

<p>Purified Mouse anti-Human Cancer Antigen 125 (CA-125) Antibody.</p>

<p>Sheep anti-Rabbit Albumin Polyclonal</p>

<p>The IGJ antibody is a monoclonal antibody that specifically targets the epidermal growth factor (EGF). It is designed to bind to EGF and neutralize its activity. This antibody has been shown to be reactive against serum albumin protein, making it an effective tool for studying the role of albumin in various biological processes. Additionally, the IGJ antibody can also be used as a research tool to study agonist proteins and their effects on cell signaling pathways. It has been demonstrated to be particularly effective against androgen-independent cell lines, suggesting its potential use in cancer research. The IGJ antibody is activated upon binding to its target antigen, allowing for the detection and quantification of EGF levels in various samples, including human serum. With its high specificity and affinity for EGF, this monoclonal antibody offers researchers a valuable tool for investigating the role of EGF in health and disease.</p>

<p>JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ</p>

<p>Monoclonal antibody raised against COVID (SARS-CoV-2) nucleoprotein. This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations.</p>

<p>Rabbit polyclonal RPL37A antibody</p>

<p>ITGB3BP antibody was raised in Rabbit using Human ITGB3BP as the immunogen</p>

Monoclonal Mouse anti-Human Cardiac Troponin I

<p>This antibody reacts with Human Apolipoprotein A-II (ApoA2), which is the second most abundant protein of the high density lipoprotein particles. ApoA2 is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D.</p>

<p>Itanapraced is a pharmaceutical compound classified as a dopamine receptor modulator, primarily sourced through synthetic chemistry processes in advanced laboratory settings. It operates by selectively binding to dopamine receptors, thereby modulating their activity to either enhance or inhibit neurotransmission depending on the specific receptor subtype targeted.</p>

<p>BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR</p>

<p>Mouse monoclonal Complement D antibody</p>

<p>The Histone H4 antibody is a growth factor monoclonal antibody that specifically binds to histone H4 proteins. It is widely used in Life Sciences research for various applications, including studying chromatin structure, gene regulation, and epigenetics. This antibody has the ability to neutralize histone H4 binding proteins and can be used to investigate their function. Additionally, the Histone H4 antibody has been shown to have reactive properties, making it an ideal tool for detecting histone H4 modifications and protein-protein interactions. Its high specificity and sensitivity make it a valuable tool for researchers working on anticancer agents, interferon signaling pathways, chemokine biology, antiviral responses, cytotoxicity studies, and multidrug resistance mechanisms. With its versatility and reliability, the Histone H4 antibody is an essential component of any research arsenal in the field of Life Sciences.</p>

<p>Bovine rotavirus is a major pathogen responsible for diarrheal disease in calves, resulting in loss of productivity and economy of farmers.</p>

<p>ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS</p>

<p>Carcinoembryonic antigen (CEA) is a tumor-specific antigen overexpressed in multiple cancers.</p>

<p>The purity of this Human IgG4 Fc is estimated to be ≥ 95 % as determined by SDS-PAGE.<br>Expressed and purified from HEK293 Cells and contains a HIS tag.</p>

<p>Dengue NS1 Protein-Type 4</p>

<p>IgG Fraction Goat anti-Cat SAA</p>

<p>anti-Human Haptoglobin Antibody</p>

<p>Affinity Purified Goat anti-Mouse IgM Antibody is validated for use in ELISA, Blotting, LFA and IHC applications.</p>

<p>HRP Conjugated Goat anti-Human IgG Fc Antibody</p>

<p>Human Transferrin Reference Serum</p>

<p>anti-Mouse Hemoglobin Antibody</p>

<p>anti-Guinea Pig IgA Antibody</p>

Purified Mouse anti-Giardia lamblia Antibody

<p>The MDM2 antibody is a highly activated antibody used in Life Sciences research. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. By binding to MDM2, this antibody inhibits its function and prevents it from interacting with other proteins involved in cell signaling pathways.</p>

<p>Human Albumin Reference Serum</p>

<p>Rabbit polyclonal GPR156 antibody</p>

<p>Affinity Purified Rabbit anti-Mouse IgA (alpha chain specific).</p>

<p>ST1936 is a peptide inhibitor of the protein interactions of FKBP-rapamycin complex and mTOR. It has been shown to inhibit the activation of mTOR by FKBP-rapamycin complex and its downstream signaling. ST1936 is an antibody that binds to the active site of human epidermal growth factor receptor (EGFR) with high affinity and specificity, inhibiting receptor tyrosine kinase activity. It has been shown to be a useful research tool for studying EGFR function in cell biology, as well as for developing antibodies against EGFR in cancer therapy.</p>

<p>The CHK1 antibody is a polyclonal antibody that specifically targets the hyaluronan receptors. It is widely used in life sciences research for the immobilization and detection of biomolecules. This antibody has been shown to be highly effective in detecting and quantifying mesenchymal stem cells that are activated. The CHK1 antibody can also be used in various applications such as chromatographic and colloidal assays. Additionally, this monoclonal antibody has cytotoxic properties and has been proven to effectively target collagen in blood plasma samples. With its high specificity and sensitivity, the CHK1 antibody is a valuable tool for researchers in the field of life sciences.</p>

<p>Rat monoclonal Granzyme B antibody (biotin)</p>

<p>Human Immunoglobulin Reference Serum</p>

<p>The GPR34 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the GPR34 antigen, which plays a crucial role in various cellular processes. This antibody is commonly used in studies related to sclerostin, collagen, and other nuclear proteins.</p>

<p>SOX17 antibody was raised in rabbit using the C terminal of SOX17 as the immunogen</p>

<p>DBCO-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DBCO-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>(±)-Stizolobic acid is an analog of the natural product indirubin and has shown potent anticancer activity in various cancer cell lines. It inhibits the replication of tumor cells by targeting human kinases involved in cell proliferation and apoptosis. Studies have shown that (±)-Stizolobic acid induces apoptosis in cancer cells by inhibiting the activity of specific proteins involved in cell signaling pathways. This compound has also been found to be present in urine samples from Chinese individuals, suggesting its potential use as a diagnostic tool for certain cancers. In addition, (±)-Stizolobic acid may serve as a promising lead for developing novel kinase inhibitors for the treatment of cancer.</p>

<p>Foot-and-mouth disease (FMD) is a severe and highly contagious viral disease. The FMD virus causes illness in cows, pigs, sheep, goats, deer, and other animals with divided hooves. It does not affect horses, dogs, or cats.</p>

<p>Purified recombinant Human KRT19 protein (His tag)</p>

BVD is endemic in most cattle-producing countries and in some countries is considered the single most important viral infection of cattle. The major reservoir responsible for disease spread geographically is the persistent infection syndrome (BVDV-PI) seen in calves

<p>Purified Mouse anti-Human Cancer Antigen 72-4 (CA 72-4) Antibody.</p>