Bioquímicos e reagentes

<p>Purified Rabbit polyclonal HLAH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2W1 antibody, catalog no. 70R-9892</p>

<p>ETV4 antibody was raised in Mouse using a purified recombinant fragment of human ETV4 (aa50-109) expressed in E. coli as the immunogen.</p>

<p>The EXO1 antibody is a substance that specifically targets and binds to an antigen. It has been extensively studied and proven effective in various research applications. The antibody can be used in gas-liquid interface experiments to study the phosphorylation site of specific proteins. Additionally, it has shown potential as a vaccine strain for the development of new medicines.</p>

<p>Rabbit polyclonal NUDCD2 antibody</p>

<p>Purified Polyclonal NIP7 antibody</p>

<p>PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of PSCA antibody, catalog no. 70R-8532

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this medication inhibits bacterial growth, preventing transcription and replication. Its bactericidal activity has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>TRAP1 antibody was raised in rabbit using the N terminal of TRAP1 as the immunogen</p>

<p>Purified Polyclonal Neurocan antibody</p>

<p>The BAD antibody is a growth factor that is commonly used in Life Sciences research. It is an amino-terminal globulin that binds to acidic binding proteins. This polyclonal antibody has antiangiogenic properties and can be used to study various signaling pathways, including those involving phosphatase and β-catenin. Additionally, the BAD antibody can be used to detect the presence of specific proteins, such as epidermal growth factor, brain natriuretic peptide, and natriuretic peptides. Its high specificity and sensitivity make it a valuable tool for researchers in the field.</p>

<p>SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP</p>

<p>Purified Polyclonal COL26A1 antibody</p>

<p>The PTBP1 antibody is a monoclonal antibody that specifically targets and inhibits the function of PTBP1, a protein involved in various cellular processes. This antibody can be used as a research tool to study the role of PTBP1 in different biological systems. It is also useful for developing inhibitors or therapeutic antibodies targeting PTBP1 for potential clinical applications. The PTBP1 antibody is widely used in life sciences research, including studies on growth factors, oncogenic kinases, and binding proteins. Its high affinity and specificity make it an ideal tool for experiments involving immobilization on electrodes or other surfaces. By blocking the activity of PTBP1, this antibody can help uncover new insights into the regulation of cellular processes and potentially lead to the development of novel therapies targeting PTBP1-related diseases.</p>

<p>The proBNP antibody is a monoclonal antibody that specifically targets proBNP, an important biomarker for heart failure. This antibody is designed to detect and quantify proBNP levels in human serum samples. It has high specificity and sensitivity, allowing for accurate and reliable measurement of proBNP levels.</p>

<p>FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.</p>

<p>Purified recombinant CAPNS1 protein (His tag)</p>

<p>ABCB8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVG</p>

<p>Mouse monoclonal CD8b antibody (FITC)</p>

<p>The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.</p>

<p>Resistin antibody was raised in goat using highly pure recombinant murine resistin as the immunogen.</p>

Rabbit polyclonal TOR3A antibody

<p>The EBV EBNA protein is a highly versatile and reactive protein that has various applications in the field of Proteins and Antigens. It has been extensively studied and found to have multiple functions. This protein is known to interact with taurine, a key amino acid found in human serum, and it has been shown to exhibit leukemia inhibitory factor (LIF) activity. Additionally, the EBV EBNA protein can be neutralized by specific monoclonal antibodies.</p>

<p>Rabbit polyclonal S1PR2 antibody</p>

<p>The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.</p>

Myozenin 1 antibody was raised using the middle region of MYOZ1 corresponding to a region with amino acids TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY

<p>Rabbit polyclonal hnRNPL antibody</p>

<p>Recombinant human ABO protein</p>

<p>CSF2RA antibody was raised in Rabbit using Human CSF2RA as the immunogen</p>

<p>Mouse monoclonal ARFGAP1 antibody</p>

<p>Rabbit polyclonal SMARCAL1 antibody</p>

<p>The GRP94 antibody is a monoclonal antibody used in the field of Life Sciences for various applications. It specifically targets biomolecules such as interleukins and is commonly used in recombination studies. The GRP94 antibody has a high affinity for its target and is known to effectively bind to interleukin-6, preventing its activity. This antibody can be utilized in different assays to detect and quantify the presence of interleukins in samples. Additionally, it has been observed that the GRP94 antibody can inhibit syncytia formation, a process involving the fusion of cells, which is important in various biological processes. With its antigen binding domain, this monoclonal antibody offers precise and accurate detection capabilities for researchers working with biomolecules and cytokines.</p>

<p>The SSB antibody is a monoclonal antibody that targets specific antigens related to glycosylation, steroids, dopamine, and fibrinogen. This antibody is used in various applications within the field of life sciences. It has been extensively studied for its role in detecting autoantibodies and nuclear antigens, as well as its potential in diagnosing certain conditions. The SSB antibody has also shown promise in research related to brain natriuretic peptide and histidine nuclear isothiocyanate. With its high specificity and reliability, this antibody is a valuable tool for researchers and scientists working in the field of life sciences.</p>

<p>CYP27C1 antibody was raised using the middle region of CYP27C1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFRA4 antibody, catalog no. 70R-10340</p>

<p>C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV</p>

<p>The GPR18 antibody is a highly specialized monoclonal antibody that plays a crucial role in endothelial growth and microvessel density. It specifically targets galectin-3-binding proteins, which are essential for the regulation of immune responses and cell signaling. This antibody has been extensively tested using immunoassays and has shown remarkable specificity and reactivity towards its target.</p>

<p>ACADSB antibody was raised in Rabbit using Human ACADSB as the immunogen</p>

<p>Mouse monoclonal Ly108 antibody (PE)</p>

<p>Purified Polyclonal Septin 7 antibody</p>

<p>TMEM161A antibody was raised using the middle region of TMEM161A corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR</p>

<p>The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.</p>

<p>Factor V antibody (biotin) was raised in sheep using human factor V purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal GJC3 antibody</p>

<p>The Syk antibody is a monoclonal antibody that specifically targets and binds to the Syk protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and signaling. By binding to Syk, the antibody inhibits its activity, which can have significant therapeutic implications.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>ZNF501 antibody was raised in rabbit using the C terminal of ZNF501 as the immunogen</p>

<p>Extracellular Ig-like domain; 22-255 amino acids: MADEEKLPPG WEKRMSRSSG RVYYFNHITN ASQWERPSGN SSSGGKNGQG EPARVRCSHL LVKHSQSRRP SSWRQEKITR TKEEALELIN GYIQKIKSGE EDFESLASQF SDCSSAKARG DLGAFSRGQM QKPFEDASFA LRTGEMSGPV FTDSGIHIIL RTE</p>

<p>The BTK antibody is a specific monoclonal antibody that targets Bruton's tyrosine kinase (BTK). It is commonly used in the field of Life Sciences for research purposes. BTK is an important protein kinase involved in various cellular processes, including the development and activation of immune cells. This antibody specifically binds to BTK, inhibiting its activity and interfering with downstream signaling pathways.</p>