Bioquímicos e reagentes

<p>CK1 antibody was raised in Mouse using a purified recombinant fragment of CK1 expressed in E. coli as the immunogen.</p>

<p>Rabbit anti-cat IgG (H+L) (Rhodamine) was raised in rabbit using feline IgG whole molecule as the immunogen.</p>

<p>Purified recombinant Human PSMB7 protein (His tag)</p>

<p>Rabbit Polyclonal Smad2 antibody (Thr220)</p>

<p>Rabbit polyclonal HP1 gamma antibody (Ser93)</p>

<p>ZIC1 antibody was raised in rabbit using the N terminal of ZIC1 as the immunogen</p>

<p>Rabbit polyclonal KAP2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NRBP2 antibody, catalog no. 70R-2615</p>

<p>The CRYAB antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the CRYAB protein, which is an important regulator of various cellular processes. The CRYAB protein belongs to the family of small heat shock proteins and has been found to play a crucial role in protecting cells from stress-induced damage.</p>

<p>Rabbit polyclonal PRPF40B antibody</p>

This antibody reacts with heavy chains on human IgM (mu chain).

<p>Purified Polyclonal LSM1 antibody</p>

<p>Azaperone Conjugate for use in immunoassays</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing bacterial growth. Extensive research has been conducted on this drug using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>DNASE2B antibody was raised using the C terminal of DNASE2B corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, which inhibits bacterial growth. Extensive research has demonstrated its high efficacy in human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at elevated levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>Rabbit polyclonal Smad2 antibody (Ser250)</p>

<p>Purified recombinant ERLIN2 protein</p>

<p>PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen</p>

<p>Purified recombinant NFKBID protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA5 antibody, catalog no. 70R-1669</p>

<p>FKTN antibody was raised in Rabbit using Human FKTN as the immunogen</p>

<p>Rabbit polyclonal TRAF4 antibody</p>

Rabbit polyclonal USP2 antibody

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved through its ability to bind to DNA-dependent RNA polymerase, which effectively prevents transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>EPS8 antibody was raised in Rabbit using Human EPS8 as the immunogen</p>

<p>Rabbit anti-sheep IgG (H+L) (Alk Phos) was raised in rabbit using sheep IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal NDUFV2 antibody (biotin)</p>

<p>Rabbit polyclonal PDGF Receptor beta antibody (Tyr751)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BC37295_3 antibody, catalog no. 70R-8171</p>

<p>Rabbit polyclonal DIRA1 antibody</p>

<p>Mouse antigen staining reagent for use in IHC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACPT antibody, catalog no. 70R-7296</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THNSL2 antibody, catalog no. 70R-4062</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEPP1 antibody, catalog no. 70R-2714</p>

<p>Calpastatin antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-Calpastatin as the immunogen.</p>

<p>Rabbit polyclonal SLC7A4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL4 antibody, catalog no. 70R-8342</p>

<p>Purified Rabbit polyclonal MGST3 antibody</p>

<p>MUC12 antibody was raised using the middle region of MUC12 corresponding to a region with amino acids PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH</p>

<p>OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC</p>

<p>COL8A1 antibody was raised in Rabbit using Human COL8A1 as the immunogen</p>

<p>ACSM3 antibody was raised in rabbit using the N terminal of ACSM3 as the immunogen</p>

<p>Purified Polyclonal Cerebellin 1 antibody</p>

<p>IRF2BP2 antibody was raised in Rabbit using Human IRF2BP2 as the immunogen</p>

<p>TOMM34 antibody was raised in rabbit using the N terminal of TOMM34 as the immunogen</p>

<p>Mouse monoclonal SHPK antibody</p>

<p>SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV</p>

<p>AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE</p>

<p>Partially purified native Human CRP protein</p>