Bioquímicos e reagentes

<p>EOS 60387 is an antibody that binds to the extracellular domain of the human protein, TRPC1. It is a cell biology research tool that can be used to study protein interactions, ion channels, and other life sciences. EOS 60387 has high purity and is available in a CAS No. 1001180-45-5 form for purchase at Life Science.</p>

<p>Rabbit polyclonal alpha catenin antibody</p>

<p>Custom research peptide; min purity 95%.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf177 antibody, catalog no. 70R-9355</p>

<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAP GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>C4ORF28 antibody was raised using the middle region of C4Orf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL</p>

<p>Rabbit polyclonal SLC45A2 antibody</p>

<p>Purified recombinant HES2 protein (His tag)</p>

<p>2-Furanyl-[4-(2-methyl-5,6,7,8-tetrahydro-[1]benzothiolo[2,3-d]pyrimidin-4-yl)-1-piperazinyl]methanone is a research tool that activates the IKr potassium channel and blocks the voltage dependent calcium channels. This compound also acts as a ligand for the GABA receptor and has been shown to inhibit protein interactions.</p>

<p>Mycoplasma pneumoniae antibody (FITC) was raised in rabbit using purified Mycoplasma pneumoniae as the immunogen.</p>

<p>Maleimide-activated BSA (BSA-M) is a maleimide-activated form of Bovine Serum Albumin (BSA). It is a peptide that can be used for immunization, as well as in biochemistry experiments. BSA-M has been shown to stimulate antibody production and can be used in the development of new vaccines.</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a central role in various cellular processes. It's a key player in the PI3K/Akt/mTOR pathway, which is essential for regulating cell growth, survival, metabolism, and proliferation.Structure: Akt has three main isoforms in humans (Akt1, Akt2, and Akt3), each encoded by different genes. Activation: Akt activation is typically initiated by external signals, such as growth factors or insulin, that bind to cell surface receptors. This activates phosphoinositide 3-kinase (PI3K), which then produces phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane. PIP3 then recruits Akt to the membrane where it is activated by two key phosphorylation events at Thr308 and Ser473. Once fully activated, Akt can move to different parts of the cell to phosphorylate its target proteins.The key functions of Akt include:Cell Survival and Anti-Apoptosis: Akt inhibits apoptosis by phosphorylating and inactivating several pro-apoptotic proteins, such as BAD and Caspase-9.Cell Growth and Proliferation: By promoting protein synthesis and inhibiting pathways that would otherwise halt the cell cycle, Akt encourages cell growth. It activates mTOR, a major regulator of protein synthesis and cellular growth.Metabolic Regulation: Akt influences metabolism by increasing glucose uptake and glycolysis, primarily through GLUT4 translocation and hexokinase activation, which is especially important in muscle and adipose tissues.Angiogenesis: Akt can stimulate the growth of new blood vessels by increasing the expression of VEGF (vascular endothelial growth factor), supporting tissue growth and repair.Cell Migration and Invasion: Akt is involved in processes that facilitate cell motility, aiding in wound healing and, unfortunately, in the spread of cancer cells.Given its role in promoting cell survival and growth, Akt is frequently hyperactivated in cancers, leading to uncontrolled cell division and tumor growth. Many cancer therapies target the PI3K/Akt/mTOR pathway to suppress this hyperactivity. Furthermore Akt's role in regulating glucose metabolism links it to insulin signaling. Defects in this pathway can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>Bis-MAL-Lysine-dPEG®4-TFP Ester is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC138 antibody, catalog no. 70R-3552</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDH8 antibody, catalog no. 70R-6133</p>

<p>MAL-dPEG®8-t-Boc-Hydrazide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®8-t-Boc-Hydrazide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Purified Polyclonal CD246 antibody</p>

<p>Rabbit Polyclonal Rb antibody (Ser795)</p>

<p>Rabbit polyclonal TCL1A antibody</p>

<p>1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine-N-(hexanoylamine) is a versatile compound that has various applications in research and chemical studies. It is commonly used as a chloride or potassium ion channel inhibitor, making it useful in experiments involving the modulation of ion channels. Additionally, this compound can be utilized as a brominated compound for specific research purposes.</p>

<p>Pyclen-OH is a peptide that is used as a research tool to study protein interactions. It is an inhibitor of the receptor for the neurotransmitter acetylcholine and has been shown to be an activator of ion channels. Pyclen-OH binds to acetylcholine receptors, which are found in many types of cells, and blocks the binding of acetylcholine. This inhibition prevents signals from being sent between nerve cells and muscles, leading to paralysis. Pyclen-OH also binds to ligand-gated ion channels, which are present in some cell membranes, and activates these ion channels by interacting with their ligands. This activation leads to increased permeability of the cell membrane, causing an influx of ions that can lead to cellular depolarization.<br>Pyclen-OH is a high purity single compound that does not contain any contaminants or impurities.</p>

<p>1,9-Dicyanonane is a reactive compound that is used in enzymatic reactions. It has an affinity for the carboxylate group of the enzyme and reacts with it to form products. 1,9-Dicyanonane can be used as an affinity label to identify enzymes in a reaction. This compound can also be labeled with stable isotopes of carbon, nitrogen, or hydrogen to make it more useful in NMR spectroscopy and mass spectrometry. The stable isotopes are usually 13C, 15N, or 2H. The use of these labels allows for calculation of the number of molecules in a sample by measuring the intensity of the peaks corresponding to the specific isotope.</p>

<p>CCNA1 antibody was raised in Rabbit using Human CCNA1 as the immunogen</p>

<p>CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA</p>

<p>Purified Polyclonal Tryptase gamma antibody</p>

<p>Toxoplasma gondii protein is a versatile compound that offers numerous benefits in the field of Life Sciences. This protein is involved in various biological processes and has been extensively studied for its potential applications. One of the key characteristics of Toxoplasma gondii protein is its role in telomerase regulation. It has been shown to influence telomere length, which plays a crucial role in cell aging and cancer development. Additionally, this protein has been found to interact with acetylcholine, a neurotransmitter involved in cognitive function and memory. Furthermore, Toxoplasma gondii protein exhibits cytotoxic properties against certain pathogens and has been investigated as a potential target for the development of inhibitors. Its interaction with acetyltransferase enzymes suggests its involvement in cholinergic signaling pathways. In addition to its biological functions, Toxoplasma gondii protein has also been employed as an antigen for the production of monoclonal antibodies. These antibodies have proven</p>

<p>Rabbit polyclonal PARD6B antibody</p>

<p>Cytochrome B5 Reductase 3, human, recombinant is a high-quality protein used in research and scientific studies. Produced using Escherichia Coli, this protein is essential for various biological processes. Cytochrome B5 Reductase 3 plays a crucial role in electron transfer reactions and is involved in the metabolism of drugs and toxins. It has been extensively studied for its ability to catalyze the reduction of cytochrome b5, an important component of the electron transport chain. This recombinant protein provides researchers with a reliable tool to investigate cellular processes and advance scientific knowledge.</p>

<p>FBXW4 antibody was raised in Rabbit using Human FBXW4 as the immunogen</p>

<p>NANOS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDDDDSDEPGSRGRYLGSALELRALELCAGPAEAGLLEERFAELSPFAGR</p>

<p>Uroguanylin is a peptide that activates the guanylate cyclase receptor. It is composed of 8 amino acids and has a molecular weight of 1036.5 Da. Uroguanylin is an agonist for the GUCY1A2 receptor, which is responsible for mediating the release of urinary and gastrointestinal hormones such as vasopressin, renin, and gastrin. Uroguanylin binds to one or more other receptors in the kidney or intestine. It can be used as a research tool in cell biology and biochemistry to study ion channels and ligands.br&gt;br&gt;<br>br&gt;br&gt;<br>Uroguanylin is also known by its CAS number 71405-27-8.BR&gt;BR&gt;</p>

<p>Anti GLP-2 (Rat) Serum is a high purity and potent activator of the GLP-2 receptor. It is a peptide that binds to the GLP-2 receptor and activates it. The GLP-2 receptor is a G protein coupled receptor that belongs to the class of receptors for peptides. Activation of this receptor leads to an increase in intracellular calcium ions and increased cell proliferation, differentiation, and survival. This product can be used as a research tool for Cell Biology, Pharmacology, or Biochemistry studies.</p>

<p>(αR,3R)-N-[3-[5-Fluoro-2-[(3-methoxy-1-methyl-1H-pyrazol-4-yl)amino]-4-pyrimidinyl]-1H-indol-7-yl]-α,3,4-trimethyl-1 -piperazineaceta mide is a peptide with the sequence N-(3-[5fluoro2[(3methoxy1methyl1Hpyrazol4yl)amino]4pyrimidinyl]-1Hindol7yl)α34trimethylpiperazineacetamide. It is an activator of ion channels and has been used to study the effects of ion channels on life science. The CAS number for this compound is 20911343577.</p>

<p>The CD28 antibody is a monoclonal antibody that inhibits the activity of CD28, a protein found on the surface of activated T cells. This antibody has been widely used in life sciences research to study the role of CD28 in immune responses. It specifically binds to CD28 and prevents its interaction with other molecules such as dopamine and vasoactive intestinal peptide, thereby modulating T cell activation and function. The CD28 antibody is highly specific for human CD28 protein and has been shown to effectively block its activity in various experimental settings. It can be used in applications such as flow cytometry, immunohistochemistry, and Western blotting to detect and analyze CD28 expression levels. Additionally, this antibody has been used to investigate the presence of autoantibodies against CD28 in certain autoimmune diseases. Its high affinity for CD28 allows for efficient targeting and potential therapeutic applications in the future.</p>

<p>E4CPG is an enzyme catalyst, which is derived from recombinant DNA technology with advanced purification processes. It accelerates biochemical reactions by providing an alternative pathway with lower activation energy, thereby increasing efficiency in various applications. This catalyst allows for precise modulation of reaction rates, maintaining substrate specificity and reducing undesired side reactions.<br><br>E4CPG is primarily used in research settings where enhanced reaction kinetics are crucial. Its applications span biochemistry, molecular biology, and industrial biotechnology. In laboratory environments, it enables more accurate study of metabolic pathways and enzyme functions. Its ability to optimize reaction conditions makes it invaluable for experimental settings requiring high precision and reliability.</p>

<p>D-Amino Acid Oxidase is an enzyme that catalyzes the conversion of D-amino acid to alpha keto acid and ammonia. It is also known as DAAO or DAO.</p>

<p>INF 4E is a monoxide that has been shown to be an effective urological treatment. It has been shown to have a catalysis effect, which reduces the formation of lactic acid and other harmful byproducts in the body. INF 4E is also an endothermic compound, which means it can absorb heat from its surroundings and release it as energy. Inflammation is one of the main causes of pathologies in the human body, so INF 4E may be used as a treatment for inflammation-related diseases.</p>

<p>Rabbit polyclonal GRIN2B antibody (N-terminus)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TXNDC13 antibody, catalog no. 70R-7432</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFC1 antibody, catalog no. 70R-2507</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Thra antibody, catalog no. 70R-8055</p>

<p>Rabbit Polyclonal PKC theta antibody (Ser695)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB9A antibody, catalog no. 70R-8642</p>

<p>ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN</p>

<p>SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEV</p>

<p>Der P1 Protein is a recombinant protein that inhibits the activity of the protease dermaseptin-1. This protein is mainly found in the skin and is an important regulator of epidermal permeability barrier function. Der P1 Protein binds to the protease and prevents it from degrading other proteins, which are essential for maintaining skin integrity. Der P1 Protein can also be used as a research tool to study protein interactions, activators, ligands, receptors, ion channels, and antibodies.</p>