Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem147 antibody, catalog no. 70R-8854</p>

<p>Rabbit polyclonal Catenin beta antibody</p>

<p>The USP37 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It specifically targets E-cadherin, a protein involved in cell adhesion and signaling. This antibody has been extensively studied in the field of life sciences, particularly in the context of chemokine and interleukin-6 signaling pathways. It has also been used in various research techniques, such as immunofluorescence staining with phalloidin to visualize actin cytoskeleton, dopamine release assays, and electrophoresis studies involving fibrinogen. The USP37 antibody has shown promising results in granulosa cell research and has been utilized in agglutination assays for detecting erythropoietin levels. Its specificity and reliability make it a valuable tool for researchers working with antibodies.</p>

<p>Rabbit polyclonal p50 CDC37 antibody</p>

<p>TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV</p>

<p>CLAD 3 Conjugate for use in immunoassays</p>

<p>Abcb10 antibody was raised in rabbit using the N terminal of Abcb10 as the immunogen</p>

<p>DHRS2 antibody was raised in rabbit using the N terminal of DHRS2 as the immunogen</p>

<p>Purified Polyclonal RhoD antibody</p>

<p>Mouse monoclonal ZIM2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DSG2 antibody, catalog no. 70R-6105</p>

<p>The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.</p>

<p>Rabbit polyclonal RPL17 antibody (FITC)</p>

<p>SLC6A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT</p>

<p>KPTN antibody was raised in Rabbit using Human KPTN as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARPC3 antibody, catalog no. 70R-3074</p>

<p>Pin1 antibody was raised in mouse using recombinant human Pin1 (1-163aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal USP38 antibody</p>

<p>Rabbit polyclonal AGP2 antibody (HRP)</p>

<p>DNAJA2 antibody was raised in Rabbit using Human DNAJA2 as the immunogen</p>

<p>Rabbit polyclonal MARK2 antibody</p>

<p>The SNAI1 antibody is a monoclonal antibody that specifically targets the SNAI1 protein. This protein plays a crucial role in various cellular processes, including cell growth and differentiation. The SNAI1 antibody has been extensively tested and validated for its specificity and sensitivity in detecting the presence of SNAI1 in different samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1B1 antibody, catalog no. 70R-1071</p>

<p>Rabbit anti-rat IgG (H+L) (Rhodamine) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>The BSG antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to BSG (basigin) protein, which is expressed on the surface of cardiomyocytes. This antibody has been shown to be effective in inhibiting the activation of BSG, making it a valuable tool for studying the role of BSG in various cellular processes. Additionally, the BSG antibody can be used as a diagnostic tool in human serum samples to detect the presence of activated BSG. With its cytotoxic properties, this monoclonal antibody has also shown promise as a potential treatment for certain types of cancer. Its ability to target nuclear proteins and inhibit protein kinases, such as mitogen-activated protein kinase and tyrosine kinases, makes it an important tool in both research and therapeutic applications.</p>

<p>KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL</p>

<p>Purified recombinant Human PITPNA protein</p>

<p>PLEKHA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV</p>

<p>Recombinant Human DCTN6 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB4 antibody, catalog no. 70R-4031</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4X1 antibody, catalog no. 70R-7249</p>

<p>TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP</p>

<p>Corticosteroid Binding Globulin (CBG) protein is a growth factor that plays a crucial role in regulating the body's response to stress and inflammation. It binds to corticosteroids, such as cortisol, in the blood, controlling their availability and activity. CBG also interacts with reactive oxygen species and antibodies, contributing to immune system function.</p>

<p>CD40 ligand protein is an activated protein that plays a crucial role in immune response and cell signaling. It is commonly used in research and diagnostic applications. The CD40 ligand protein has an antigen binding domain that interacts with the CD40 receptor on B cells, leading to their activation and differentiation. This protein can be used as a tool in various assays, such as chemiluminescent immunoassays or DNA vaccines. It can also be conjugated to other molecules, such as monoclonal antibodies or chemokines, for specific applications. The CD40 ligand protein is stable and can be easily immobilized on surfaces like carbon electrodes for electrode-based assays. Its structure consists of amino acid residues that are methylated, providing stability and enhancing its functionality. Researchers in the life sciences field often rely on this protein to investigate immune responses and develop new therapeutic strategies.</p>

<p>Rabbit polyclonal MRPL48 antibody</p>

<p>DGAT2L7 antibody was raised in rabbit using the C terminal of DGAT2L7 as the immunogen</p>

<p>Purified recombinant Angiogenin protein (His tag)</p>

<p>The Myc antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the c-myc protein, which plays a crucial role in cell growth and proliferation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.</p>

<p>NR5A2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal JunD antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COMT antibody, catalog no. 70R-7143</p>

<p>PAPOLB antibody was raised using the middle region of PAPOLB corresponding to a region with amino acids MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM</p>

<p>USP38 antibody was raised in rabbit using the middle region of USP38 as the immunogen</p>

<p>The HA Tag antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to specifically bind to the HA (hemagglutinin) epitope, which is commonly fused to target molecules for various applications. The HA Tag antibody is commonly used in immunoassays and antigen binding experiments to detect and quantify the expression of target proteins.</p>

<p>The TRPV4 antibody is a highly specialized monoclonal antibody that targets the transient receptor potential vanilloid 4 (TRPV4) channel. This channel plays a crucial role in various physiological processes, including natriuretic regulation, fibrinogen production, and cellular response to mechanical stress. The TRPV4 antibody has been extensively tested in human serum and has shown excellent specificity and sensitivity in detecting TRPV4 expression.</p>

<p>LRRC2 antibody was raised using the N terminal of LRRC2 corresponding to a region with amino acids GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA</p>

<p>PSMC6 antibody was raised in rabbit using the C terminal of PSMC6 as the immunogen</p>

<p>The EDNRA antibody is a polyclonal antibody that has been extensively studied and widely used in various applications. It is commonly used in CDNA microarray experiments to analyze gene expression profiles and identify potential biomarkers. The EDNRA antibody specifically targets the endothelin receptor type A (EDNRA), which plays a crucial role in cellular immunotherapy and the development of targeted therapies for various diseases.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>HEPACAM antibody was raised in Rabbit using Human HEPACAM as the immunogen</p>