Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.185 produtos)
- Por Alvo Biológico(99.150 produtos)
- Por uso/Efeitos Farmacológicos(6.789 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.764 produtos)
- Metabólitos secundários(14.307 produtos)
Foram encontrados 130581 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
MAP2K2 antibody
<p>The MAP2K2 antibody is a highly effective monoclonal antibody that has neutralizing properties. It acts by targeting and inhibiting the activity of MAP2K2, a protein involved in cellular signaling pathways. This antibody is particularly useful in studies involving antibodies, autoantibodies, interferon, and colony-stimulating factors. It has been extensively tested on various cell lines, including MCF-7 cells, and has shown excellent results in blocking the activity of MAP2K2. Additionally, this antibody has been found to have inhibitory effects on antiphospholipid antibodies and other factors that contribute to disease progression. With its high specificity and potency, the MAP2K2 antibody is an invaluable tool for researchers studying signal transduction pathways and developing targeted therapies.</p>SB-649868
CAS:<p>SB-649868 is a drug in clinical development for the treatment of sleep-wake disorders. It is a potent and selective allosteric modulator of the GABAA receptor, with a profile that includes high affinity for the α1β2γ2 subtype. SB-649868 has been shown to increase slow wave sleep and delta power during wakefulness in healthy human subjects. SB-649868 has also been shown to have no effect on blood pressure or heart rate at clinically relevant doses, suggesting reduced risk for cardiovascular side effects.<br>SB-649868 was well tolerated in preclinical studies, without serious adverse events observed.</p>Fórmula:C26H24FN3O3SPureza:Min. 95%Peso molecular:477.55 g/molMMP9 antibody
<p>MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.</p>Pureza:Min. 95%CTAP
CAS:<p>Please enquire for more information about CTAP including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C51H67N13O11SPureza:Min. 95%Peso molecular:1,070.22 g/molEGFR antibody
<p>EGFR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%ST 198
CAS:<p>ST 198 is an antimicrobial agent that has been shown to be long-term treatment for humans. It reduces the incidence of antimicrobial resistance by acting as a reactive agent that binds to dopamine, which prevents its reuptake into the cell. ST 198 has also been shown to have no effect on locomotor activity and gene analysis in mice with psychotic disorder. ST 198 is an experimental drug that is being developed for use in diagnostic tests for Neisseria meningitidis and other bacterial infections.<br>ST 198 has been shown to inhibit the receptor activity of bacteria, including the n. meningitidis strain, which can lead to a decrease in the severity of symptoms and duration of illness if administered early during an infection.</p>Fórmula:C22H26N2OPureza:Min. 95%Peso molecular:334.5 g/molTAAR5 antibody
<p>TAAR5 antibody was raised in rabbit using the C terminal of TAAR5 as the immunogen</p>Pureza:Min. 95%CACYBP antibody
<p>CACYBP antibody is a serum marker used in Life Sciences to detect the presence of dopamine. It is commonly used in research involving pluripotent stem cells. This antibody specifically targets CACYBP, a protein involved in various cellular processes. The CACYBP antibody can be used for chromatographic and immunological assays to study the activation and function of CACYBP. It can also be used as a diagnostic tool to detect autoantibodies associated with certain diseases. Additionally, this antibody can be used in the development of monoclonal antibodies or other therapeutic agents targeting CACYBP. Its application extends to studies involving methyl transferase activity, interferon-stimulated gene expression, acetylcholine signaling, and transmembrane conductance.</p>CD11b antibody (Spectral Red)
<p>CD11b antibody (FITC) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>Pureza:Min. 95%VU 0360223
CAS:<p>VU 0360223 is a selective positive allosteric modulator of the metabotropic glutamate receptor subtype 5 (mGluR5), a type of receptor found in the central nervous system. Synthesized through medicinal chemistry efforts, it serves as a tool compound for neuroscientific research related to glutamatergic signaling.</p>Fórmula:C15H9FN2SPureza:Min. 95%Peso molecular:268.31 g/molCabergoline-d5
CAS:<p>Please enquire for more information about Cabergoline-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H37N5O2Pureza:Min. 95%Peso molecular:456.6 g/molβ catenin antibody
<p>The Beta catenin antibody is a highly versatile antibody that plays a crucial role in various biological processes. It is commonly used in life sciences research, particularly in the field of pluripotent stem cells. This antibody specifically targets β-catenin, a protein that is involved in cell adhesion and signaling pathways.</p>Pureza:Min. 95%BDP FL DBCO
CAS:<p>BDP FL DBCO is a synthetic peptide that binds to the GABA receptor. BDP FL DBCO is used in cell biology and research as an inhibitor of ion channels, ligand for the GABA receptor, or as a reagent to detect antibodies against GABA receptors.</p>Fórmula:C32H29BF2N4O2Pureza:Min. 95%Peso molecular:550.4 g/molβ Actin antibody
<p>The beta Actin antibody is a highly specific monoclonal antibody that targets the beta-actin protein. It is widely used in research and diagnostic applications to detect and quantify the expression levels of beta-actin in various samples, including human serum. This antibody has been proven to be cytotoxic towards cells expressing sclerostin, an antigen associated with bone disorders. The beta Actin antibody can be used in a variety of assays, including Western blotting, immunohistochemistry, and flow cytometry, to study the localization and function of beta-actin in different cellular contexts. Its high specificity and sensitivity make it an indispensable tool for researchers studying cellular processes such as cell motility, cytoskeletal dynamics, and intracellular signaling pathways involving beta-actin.</p>USP7 antibody
<p>The USP7 antibody is a monoclonal antibody that specifically binds to the receptor for colony-stimulating factor (CSF). This antibody has been shown to have cytotoxic effects on cells that express high levels of the CSF receptor, making it a promising therapeutic option in the field of life sciences. The USP7 antibody works by neutralizing the activity of CSF, which is a growth factor involved in cell proliferation and differentiation. By blocking the binding of CSF to its receptor, this antibody inhibits the downstream signaling pathways that promote cell growth and survival. Additionally, the USP7 antibody has been found to interact with calmodulin and form dimers, which further enhances its cytotoxic effects. With its ability to selectively target activated cells expressing high levels of the CSF receptor, this monoclonal antibody holds great potential for targeted therapy in various diseases.</p>CD11a antibody (PE-CY7)
<p>CD11a antibody (biotin) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>Pureza:Min. 95%16:0-16:0-d31 Pc
CAS:Produto Controlado<p>16:0-16:0-d31 Pc is a synthetic peptide that is used as an inhibitor of 16:0-16:0 binding to the receptor. The peptide has been shown to bind to the ligand binding domain in the extracellular loop of the receptor and prevent it from activating the ion channels. This peptide is also used as a research tool for studying protein interactions, and can be used in pharmacology, life science, and cell biology.</p>Fórmula:C40H49NO8PD31Pureza:Min. 95%Peso molecular:765.23 g/molCD41a antibody (biotin)
<p>CD41a antibody (biotin) was raised in ouse using human PBL as the immunogen.</p>Pureza:Min. 95%IGSF1 antibody
<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC</p>Pureza:Min. 95%(3R,5R)-Rosuvastatin sodium salt
CAS:<p>Inhibitor of HMG-CoA reductase</p>Fórmula:C22H27FN3O6S·NaPureza:Min. 95%Peso molecular:503.52 g/molHSPC111 antibody
<p>HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR</p>R-S-R
<p>Please enquire for more information about R-S-R including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H31N9O5Pureza:Min. 95%Peso molecular:417.46 g/molST3GAL4 antibody
<p>The ST3GAL4 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the ST3GAL4 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in applications such as immunohistochemistry, immunofluorescence, Western blotting, and flow cytometry.</p>Phencynonate
CAS:<p>Phencynonate is an inhibitor that has shown promising results in the treatment of cancer. It works by inhibiting the activity of certain kinases, which are enzymes involved in cell signaling pathways. This inhibition leads to apoptosis, or programmed cell death, in cancer cells. Phencynonate is a medicinal protein analog that has been extensively studied in Chinese medicine for its anticancer properties. In addition to its direct effects on tumor cells, phencynonate has also been shown to have an impact on urine output and kidney function. Overall, this inhibitor shows great potential as a targeted therapy for various types of cancer in humans.</p>Fórmula:C22H31NO3Pureza:Min. 95%Peso molecular:357.5 g/molAlkaline Phosphatase antibody
<p>The Alkaline Phosphatase antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the alkaline phosphatase enzyme, which plays a crucial role in various biological processes such as glycosylation, exocytosis, and nuclear signaling. This antibody binds to the active site of alkaline phosphatase and inhibits its activity, allowing researchers to study the effects of its inhibition on cellular functions.</p>Pureza:Min. 95%Abt 239 tartrate
CAS:<p>Abt 239 tartrate is a peptide that inhibits protein interactions. It is used as a research tool and an antibody in the study of ion channels and receptor function. Abt 239 tartrate has a molecular weight of 6,788.50 Da, an empirical formula of C22H30N6O8, and a chemical structure that includes one L-amino acid residue, one D-amino acid residue, and two ester groups. Abt 239 tartrate is soluble in water at concentrations up to 10 mg/mL with slight turbidity. In order to avoid precipitation or discoloration, it should be dissolved in water at pH 8 or higher. The CAS Number for this compound is 460748-71-4.</p>Fórmula:C26H28N2O7Pureza:Min. 95%Peso molecular:480.5 g/molMLS 1547
CAS:<p>MLS 1547 is a selective D2 dopamine receptor agonist that was designed to have a high degree of selectivity for the D2 receptor subtype. MLS 1547 has low expression in cells and tissues, which may be due to its lack of hydroxyl groups. The agonist binding site on the D2 receptor is located at the extracellular end, and this drug interacts with it to suppress tumour growth. MLS 1547 also binds to other dopamine receptors and can inhibit tyrosine hydroxylase activity, leading to reduced dopamine synthesis and release. This compound also inhibits the proliferation of cancer cells by suppressing cellular proliferation in the extracellular space.</p>Fórmula:C19H19ClN4OPureza:Min. 95%Peso molecular:354.83 g/molMeclizine-d8 N’-oxide
CAS:<p>Please enquire for more information about Meclizine-d8 N’-oxide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C25H27ClN2OPureza:Min. 95%Peso molecular:415 g/molCarbonic anhydrase 1 protein (His tag)
<p>1-261 amino acids: MGSSHHHHHH SSGLVPRGSH MASPDWGYDD KNGPEQWSKL YPIANGNNQS PVDIKTSETK HDTSLKPISV SYNPATAKEI INVGHSFHVN FEDNDNRSVL KGGPFSDSYR LFQFHFHWGS TNEHGSEHTV DGVKYSAELH VAHWNSAKYS SLAEAASKAD GLAVIGVLMK VGEANPKLQK VLDALQAIKT KGKRAPFTNF DPSTLLPSSL DFWTYPGSLT HPPLYESVTW IICKESISVS SEQLAQFRSL LSNVEGDNAV PMQHNNRPTQ PLKGRTVRAS F</p>Pureza:Min. 95%Dendritic Cell antibody
<p>The Dendritic Cell antibody is a monoclonal antibody that specifically targets dendritic cells. Dendritic cells play a crucial role in the immune system by presenting antigens to T cells and initiating an immune response. This antibody binds to the GM-CSF receptor on dendritic cells, promoting their maturation and activation.</p>3-Bodipy-propanoylaminocaproic acid N-hydroxysuccinimide ester
CAS:<p>Fluorescent dye for labeling amines</p>Fórmula:C24H29BF2N4O5Pureza:Min. 95%Cor e Forma:Red solid.Peso molecular:502.32 g/molZafirlukast-d7
CAS:<p>Please enquire for more information about Zafirlukast-d7 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C31H33N3O6SPureza:Min. 95%Peso molecular:582.7 g/molTPH2 antibody
<p>TPH2 antibody was raised using the N terminal of TPH2 corresponding to a region with amino acids REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS</p>CD11c antibody (FITC)
<p>CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.</p>Pureza:Min. 95%PREB antibody
<p>PREB antibody was raised in rabbit using the N terminal of PREB as the immunogen</p>Pureza:Min. 95%Viprostol
CAS:<p>Viprostol is an analog of capsaicin that has been shown to have anticancer properties. It is a potent inhibitor of tumor cell growth and induces apoptosis in human cancer cells. Viprostol works by inhibiting protein kinases, which are enzymes that play a key role in regulating cell growth and division. This drug has been found to be effective against various types of cancer, including lung, breast, and colon cancer. Viprostol has also shown promising results in inhibiting the growth of Chinese hamster ovary cells and has been used to treat urinary disorders.</p>Fórmula:C23H36O5Pureza:Min. 95%Peso molecular:392.5 g/molLapatinib ditosylate monohydrate
CAS:<p>Inhibitor of EGFR (ErbB1) and HER2 (ErbB2) receptor tyrosine kinases. Used for sensitization of HER2-overexpressing cancer cells to radiation as well as chemotherapy to tamoxifen- and trastuzumab-resistant cell lines. The compound blocks signalling via Akt and mitogen-activated protein kinase (MAPK) pathways leading to reduced cell survival. In trastuzumab resistant cancer cells, it inhibits HER2 phosphorylation, prevents receptor ubiquitination and causes accumulation of inactive HER2 dimers on the cell surface.</p>Fórmula:C29H26ClFN4O4S•(C7H8O3S)2•H2OPureza:Min. 95%Peso molecular:943.48 g/molCEBP γ protein (His tag)
<p>DNA binding domain 39-147 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMPGG GGKAVAPSKQ SKKSSPMDRN SDEYRQRRER NNMAVKKSRL KSKQKAQDTL QRVNQLKEEN ERLEAKIKLL TKELSVLKDL FLEHAHNLAD NVQSISTENT TADGDN</p>Pureza:Min. 95%Mc-Val-Ala-pbd
CAS:<p>Mc-Val-Ala-pbd is a potent anticancer agent that belongs to the class of protein kinase inhibitors. It is an analog of urine-derived kininogen and has been shown to induce apoptosis in human cancer cells. Mc-Val-Ala-pbd works by inhibiting the activity of specific kinases that are involved in tumor growth and progression. This inhibitor has demonstrated high efficacy against a variety of cancer cell lines, including those resistant to other chemotherapy drugs. Additionally, Mc-Val-Ala-pbd has been found to have synergistic effects when combined with nalbuphine, another anticancer drug. Overall, Mc-Val-Ala-pbd shows great promise as a potential treatment option for cancer patients.</p>Fórmula:C60H64N8O12Pureza:Min. 95%Peso molecular:1,089.2 g/molPD 168568
CAS:<p>PD 168568 is a research tool that activates the receptor. It is also a ligand that binds to the receptor and may be useful for studying protein interactions. PD 168568 is an inhibitor of ion channels, which are pores in cell membranes that allow the flow of ions across the membrane. PD 168568 inhibits the opening of potassium channels, which causes hyperpolarization and prevents action potentials from occurring. This drug has also been shown to inhibit voltage-gated calcium channels and suppress calcium signaling in cells.</p>Fórmula:C22H29Cl2N3OPureza:Min. 95%Peso molecular:422.4 g/molNF kappaB p65 antibody
<p>The NF kappaB p65 antibody is a polyclonal antibody that specifically targets the protein NF kappaB p65. This antibody is widely used in life sciences research to study the role of NF kappaB p65 in various biological processes. NF kappaB p65 is a transcription factor that plays a crucial role in regulating gene expression. It forms a complex with other proteins and binds to specific DNA sequences, thereby controlling the transcription of target genes involved in immune response, inflammation, cell survival, and development.</p>Pureza:Min. 95%
