Bioquímicos e reagentes

<p>The NF kappaB p65 antibody is a polyclonal antibody that specifically targets the protein NF kappaB p65. This antibody is widely used in life sciences research to study the role of NF kappaB p65 in various biological processes. NF kappaB p65 is a transcription factor that plays a crucial role in regulating gene expression. It forms a complex with other proteins and binds to specific DNA sequences, thereby controlling the transcription of target genes involved in immune response, inflammation, cell survival, and development.</p>

<p>Antagonist of TRPC4/C5 channels</p>

<p>CD62L antibody (Allophycocyanin) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.</p>

<p>Caffeine-d3 is a cell-permeable analogue of caffeine that can be used as an internal standard for the quantification of caffeine in mammalian cells. Caffeine-d3 may also be used to measure the elimination rate of caffeine from animal tissues and to study the effect of matrix components on drug uptake. It may also be used to study the activity of hydroxyzine and theophylline, which is due to their structural similarity with caffeine. Caffeine-d3 is a fatty acid that can act as a cellular messenger through activation or inhibition of adenosinergic receptors.</p>

<p>NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG</p>

<p>Mouse monoclonal PPME1 antibody</p>

<p>Purified Polyclonal Cytochrome P450 3A4/5 antibody</p>

<p>The CDCP1 antibody is a growth factor that plays a crucial role in various cellular processes. It is an apical membrane protein and has been found to be a potential target for anti-CD20 antibodies. The CDCP1 antibody specifically recognizes and binds to the human folate receptor, inhibiting its activity. This monoclonal antibody has been extensively studied in the field of life sciences and has shown promising results as a therapeutic agent. Its unique glycosylation pattern allows for enhanced stability and efficacy. Additionally, the CDCP1 antibody has been found to activate signaling pathways involved in hepatocyte growth, making it a valuable tool for research in this area. With its high specificity and affinity towards its target antigen, this monoclonal antibody is a powerful tool for scientists and researchers alike.</p>

<p>K-252D is a potent and selective antagonist of the voltage-gated potassium channel Kv2.1. It acts as an inhibitor of potassium ion channels and is used in research for studying the function of voltage-gated potassium channels.</p>

<p>GRWD1 antibody was raised in Rabbit using Human GRWD1 as the immunogen</p>

<p>Recombinant Human IL13RA1 protein with His tag</p>

<p>CD107a antibody (Allophycocyanin) was raised in rat using murine CD107a (LAMP-1) as the immunogen.</p>

<p>IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ</p>

<p>PDE5A Antibody</p>

<p>Pd-1/Pd-L1-in-8 is an inhibitor that targets the PD-1/PD-L1 pathway, which is involved in regulating immune responses. This inhibitor has been developed by Chinese researchers and has shown promising results in preclinical studies as a potential treatment for various types of cancer. Pd-1/Pd-L1-in-8 is a kinase inhibitor that works by blocking the activity of specific kinases involved in cancer cell growth and survival. It induces apoptosis, programmed cell death, in cancer cells and shows potent anticancer activity. The analog of this medicinal compound has been isolated from human urine and demonstrates significant potential as an anticancer drug.</p>

<p>ZT-1a is a potent inhibitor of protein kinases that play a crucial role in the cell cycle and cancer cell growth. It has been shown to induce apoptosis in human cancer cell lines by inhibiting the phosphorylation of key proteins involved in cell cycle regulation. ZT-1a has been found to be effective against various types of cancer, including breast, lung, and prostate cancer. This inhibitor works by blocking the activity of specific kinases that are overexpressed in cancer cells, causing them to undergo programmed cell death. The unique mechanism of action of ZT-1a makes it a promising candidate for the development of novel cancer therapies.</p>

<p>Mouse monoclonal M-Ficolin antibody</p>

<p>Nebentan is a peptide that belongs to the class of activators. It has been shown to activate the c-Jun N-terminal kinase and phosphatidylinositol 3 kinase pathways in cells. The high purity of this drug makes it an ideal research tool for studying protein interactions, receptor binding and ligand pharmacology. Nebentan is a potent inhibitor of ion channels, which may provide therapeutic benefits for diseases such as epilepsy.</p>

<p>Rabbit polyclonal TNKS1BP1 antibody</p>

<p>Phe-Met-MCA is a peptide that specifically activates the ATP-sensitive potassium (KATP) channels. These channels are important for regulating cellular energy metabolism and membrane potential. Phe-Met-MCA is an inhibitor of protein kinase C (PKC), which regulates the activity of KATP channels by phosphorylation. The peptide is also an inhibitor of other protein kinases, including PKCζ, PKCε, and PKCθ.</p>

<p>Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids HELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP</p>

<p>Rimcazole dihydrochloride is a drug that is used in the treatment of chronic cough. It belongs to the class of drugs called anticholinergic drugs. The drug binds to receptors found on the surface of cells, including kappa-opioid receptors, and blocks the action of acetylcholine. This prevents the release of substances that cause inflammation and muscle contractions. Rimcazole also has minimal toxicity and does not have any significant interactions with other drugs when administered alone or in combination preparations. However, it should not be administered to patients who are taking active antiretroviral therapy or those with carcinoma cell lines because it may increase their risk for serious side effects.</p>

<p>NKIRAS1 antibody was raised using the N terminal of NKIRAS1 corresponding to a region with amino acids CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV</p>

<p>AVE 5688 is a drug that inhibits the synthesis of acid molecules and analogs, which are compounds that inhibit the enzyme nitric oxide synthase. It has been shown to inhibit the growth of influenza virus and herpes simplex virus in cell culture. AVE 5688 also has structural formula similar to dimethyl fumarate, which is an immunomodulator used for treatment of metabolic disorders and autoimmune diseases. The oral dosage form of AVE 5688 is currently being evaluated for prevention or treatment of hyperproliferative or autoimmune diseases.</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>PDE9-IN-(S)-C33 is a phosphodiesterase inhibitor that is used in the treatment of heart diseases such as cardiac hypertrophy. PDE9-IN-(S)-C33 inhibits the activity of phosphodiesterase (PDE) type 9, which breaks down cyclic guanosine monophosphate (cGMP). This leads to an increase in intracellular cGMP levels and an inhibition of cardiac hypertrophy. PDE9-IN-(S)-C33 also has a beneficial effect on neonatal rat cardiomyocytes, which may be due to its ability to inhibit transition from hyperplasia to hypertrophy.</p>

<p>Purified recombinant Human CLTB protein (His tag)</p>

<p>YK 3-237 is a potent inhibitor of the p21 protein, which is involved in cell cycle regulation and apoptosis. YK 3-237 has been shown to inhibit the transcriptional activity of transcription polymerase chain (PCR) by binding to the RNA polymerase II enzyme. This inhibition prevents mda-mb-231 breast cancer cells from proliferating and induces apoptosis. YK 3-237 also inhibits epidermal growth factor, which may be involved in the development of cancerous tumors. It has been observed that YK 3-237 blocks angiogenesis, hiv infection and monoclonal antibody production in vitro.</p>

<p>N-Palmitoyl(d9) D-erythro-sphingosine is a fatty acid that is used as a research tool for receptor and ligand binding assays. This product is also used in Cell Biology to study protein interactions and in Pharmacology as an inhibitor of ion channels. In the Life Science industry, it is used to study the effects of membrane fluidity on ion channel activity. N-Palmitoyl(d9) D-erythro-sphingosine has been shown to activate G protein coupled receptors and inhibit K+ channels in human cells. It also binds with high affinity to antibodies raised against peptides containing palmitic acid residues.</p>

<p>SAR131675 is a drug that acts as a tyrosine kinase inhibitor. It has been shown to have an effect on the growth of cancer cells and has been shown to be effective in treating inflammatory bowel disease. SAR131675 inhibits the activity of protein tyrosine kinases, which are enzymes that phosphorylate proteins and regulate their biological functions. The drug is selective for certain kinases, such as c-kit, stem cell factor receptor (c-Kit), and platelet-derived growth factor receptor (PDGFR). SAR131675 has been shown to be safe and effective in treating diseases such as cancer or inflammatory bowel disease when administered at an effective dose.</p>

<p>Rabbit polyclonal RHOXF2 antibody</p>

<p>p-Methyl atomoxetine hydrochloride is a selective norepinephrine reuptake inhibitor, which is synthesized from chemical precursors typically through a series of organic reactions proceeding under controlled conditions. It functions by inhibiting the reuptake of norepinephrine in the synaptic cleft, resulting in increased concentrations of this neurotransmitter in the central nervous system.</p>

<p>Rabbit polyclonal TEX12 antibody</p>

<p>The AK3 antibody is a nephrotoxic monoclonal antibody that is used in the field of Life Sciences. It has been extensively studied for its ability to detect protein biomarkers in various biological samples, including human serum. The AK3 antibody specifically targets histidine residues and can be used as a tool for the detection and quantification of proteins that contain this amino acid. It has also been shown to have inhibitory effects on epidermal growth factor and alpha-fetoprotein, making it a valuable tool for research in cancer biology. The AK3 antibody is commonly used in immunoassays and can be utilized with techniques such as carbon electrode-based assays or colloidal gold-based assays. Its high specificity and sensitivity make it an essential component in many research laboratories.</p>

<p>L-A-Phosphatidylcholine is a natural product that is extracted from the Chinese herb Salvia miltiorrhizae. It is a phospholipid that has been shown to inhibit the growth of colorectal adenocarcinoma cells in vitro. The mechanism of action for L-A-Phosphatidylcholine is unclear, but it may be due to its ability to inhibit the activity of polymerase chain reaction (PCR) and nitrite ion. L-A-Phosphatidylcholine also inhibits fatty acid uptake and acyl chain synthesis in vitro, as well as hydrogen bond formation with the hydroxyl group and water vapor uptake. L-A-Phosphatidylcholine also has a strong affinity for nitrate ions, which may be related to its anti-inflammatory effects.</p>

<p>DNA-PK and PI 3-K inhibitor</p>

<p>HTR3A antibody was raised in rabbit using the middle region of HTR3A as the immunogen</p>

<p>Noggin antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Noggin protein as the immunogen.</p>

<p>Capsiconiate is a natural compound derived from the Capsicum family of plants, specifically through the esterification of capsinoids, which are non-pungent analogs of capsaicinoids. It is derived from sources such as sweet peppers and other Capsicum varieties. Unlike its pungent counterparts, capsiconiate is characterized by its milder sensory perception while retaining significant bioactivity.</p>

<p>Psenen antibody was raised in rabbit using the N terminal of Psenen as the immunogen</p>

<p>TWEAK antibody was raised in goat using highly pure recombinant human TWEAK as the immunogen.</p>

<p>Please enquire for more information about Levulinic-d5 acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GHRP 4 TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(2-(8,9-Dioxo-2,6-diazabicyclo(5.2.0)non-1(7)-en-2-yl)ethyl)phosphonic acid is a potent inhibitor of protein kinases that play a crucial role in the regulation of cell cycle and apoptosis. This compound has shown promising results in inhibiting cancer cell growth both in vitro and in vivo. It has been tested on human urine and Chinese hamster ovary cells lines, and it has demonstrated significant antitumor activity against various types of cancer. (2-(8,9-Dioxo-2,6-diazabicyclo(5.2.0)non-1(7)-en-2-yl)ethyl)phosphonic acid works by blocking the activity of specific kinases involved in tumor progression and metastasis. This medicinal compound is an exciting prospect for developing new inhibitors for cancer treatment.</p>

<p>CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.</p>

<p>ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID</p>

<p>OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen</p>

<p>Nuvenzepine is a potent and selective muscarinic antagonist, synthesized from intricate chemical processes involving non-peptidic structures. Its primary mode of action involves inhibiting muscarinic acetylcholine receptors, particularly those located in the gastrointestinal tract. By impeding these receptors, Nuvenzepine effectively reduces gastric secretions and modulates smooth muscle activity.</p>

<p>CD45R antibody (PE-CY5.5) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>The OR1D2 antibody is a highly specialized fibroin that exhibits cytotoxic properties. This antibody specifically targets TGF-beta, a key protein involved in various cellular processes. It also interacts with fibrinogen, a crucial protein for blood clotting. The OR1D2 antibody is available as both polyclonal and monoclonal antibodies, providing flexibility for different research needs. In addition, it has been shown to inhibit caspase-9 activity, an enzyme involved in apoptosis. Researchers in the life sciences field can utilize this antibody as a valuable tool for studying signal transduction pathways and family kinase inhibitors. Its immobilization capabilities make it ideal for binding proteins on surfaces or electrodes, facilitating various experimental setups.</p>