Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.130 produtos)
- Por Alvo Biológico(99.159 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.747 produtos)
- Metabólitos secundários(14.222 produtos)
Foram encontrados 130579 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
CASP4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CASP4 antibody, catalog no. 70R-9650</p>Pureza:Min. 95%Arginase 2 antibody
<p>The Arginase 2 antibody is a cytotoxic monoclonal antibody that specifically targets and binds to the Arginase 2 protein isoforms. This antibody has been extensively tested using techniques such as electrophoresis and polymerase chain reaction to ensure its specificity and effectiveness. It has shown high affinity towards the Arginase 2 protein complex, inhibiting its activity and preventing the conversion of arginine into ornithine and urea.</p>PERLD1 antibody
<p>PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV</p>Pureza:Min. 95%LOC645015 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC645015 antibody, catalog no. 70R-2372</p>Pureza:Min. 95%CSTF3 antibody
<p>CSTF3 antibody was raised using the N terminal of CSTF3 corresponding to a region with amino acids YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE</p>RG9MTD1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RG9MTD1 antibody, catalog no. 70R-4806</p>Pureza:Min. 95%DDX17 antibody
<p>DDX17 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 17 (Ddx17)</p>NECAP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NECAP2 antibody, catalog no. 70R-3814</p>Pureza:Min. 95%Goat anti Human IgG (HRP)
<p>Goat anti-human IgG (HRP) was raised in goat using human IgG gamma chain as the immunogen.</p>Pureza:Min. 95%Wdr45l antibody
<p>Wdr45l antibody was raised in rabbit using the N terminal of Wdr45l as the immunogen</p>Pureza:Min. 95%MLLT4 antibody
<p>MLLT4 antibody was raised in rabbit using the N terminal of MLLT4 as the immunogen</p>Pureza:Min. 95%Rabbit anti Mouse IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Pureza:Min. 95%GC Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GC antibody, catalog no. 70R-10252</p>Pureza:Min. 95%ANKRD47 antibody
<p>ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLK</p>Cullin 5 antibody
<p>Cullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH</p>CD49e antibody
<p>CD49e antibody is a monoclonal antibody that targets the CD49e protein, also known as integrin alpha 5. This protein is involved in cell adhesion and plays a crucial role in various biological processes, including growth factor signaling and tissue development. CD49e antibody inhibits the function of CD49e, thereby preventing its interaction with other molecules and interfering with cellular processes.</p>ZNF652 antibody
<p>ZNF652 antibody was raised in rabbit using the N terminal of ZNF652 as the immunogen</p>Pureza:Min. 95%ALPK1 antibody
<p>The ALPK1 antibody is a highly specific monoclonal antibody that targets the ALPK1 protein. This protein plays a crucial role in various cellular processes, including oncostatin signaling and β-catenin activation. The ALPK1 antibody has been extensively tested and validated for its specificity, ensuring accurate and reliable results in experiments.</p>ADORA2A antibody
<p>ADORA2A antibody was raised in rabbit using the N terminal of ADORA2A as the immunogen</p>Pureza:Min. 95%Matrilin 2 antibody
<p>Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED</p>Na+ Ca2+ Exchanger antibody (cardiac)
<p>Na+ Ca2+ exchanger antibody (cardiac) was raised in rabbit using canine cardiac sarcolemma Na+/Ca2+ exchanger as the immunogen.</p>CLECL1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLECL1 antibody, catalog no. 70R-2329</p>Pureza:Min. 95%RASSF1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RASSF1 antibody, catalog no. 70R-9845</p>Pureza:Min. 95%RAVER2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAVER2 antibody, catalog no. 70R-4637</p>Pureza:Min. 95%Chicken anti Rat IgG (H + L) (Alk Phos)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Pureza:Min. 95%SIX1 antibody
<p>The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.</p>CDH7 antibody
<p>The CDH7 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists working in the area of antigen-antibody reactions. This antibody specifically targets acetylcholine, a neurotransmitter involved in various physiological processes.</p>CLN6 antibody
<p>CLN6 antibody was raised using the middle region of CLN6 corresponding to a region with amino acids LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL</p>Pureza:Min. 95%HLA-F Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HLA-F antibody, catalog no. 70R-6432</p>Pureza:Min. 95%YIF1B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YIF1B antibody, catalog no. 70R-6837</p>Pureza:Min. 95%
