Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB3IP antibody, catalog no. 70R-4196</p>

<p>The Vimentin antibody is a powerful tool for research in various fields. It is a monoclonal antibody that specifically targets vimentin, a protein involved in cell structure and movement. This antibody can be used to study the role of vimentin in different cellular processes, such as cell migration, invasion, and metastasis.</p>

<p>GRHL3 antibody was raised in rabbit using the C terminal of GRHL3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE4A antibody, catalog no. 70R-2780</p>

<p>Rabbit polyclonal PARP11 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The metabolization of this drug involves various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>Mouse monoclonal Reticulon 1C antibody</p>

<p>Mouse monoclonal SH3GL1 antibody</p>

<p>Purified Polyclonal PPP1R14D antibody</p>

<p>Rabbit polyclonal RPA3 antibody (biotin)</p>

<p>BLVRA antibody was raised in Rabbit using Human BLVRA as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D1 antibody, catalog no. 70R-2415</p>

<p>Rabbit Polyclonal NFkB p65 antibody (Ser468)</p>

<p>Rabbit polyclonal OR4E2 antibody</p>

<p>NT5C1B antibody was raised using the N terminal of NT5C1B corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT</p>

<p>The Nur77 antibody is a highly versatile and effective tool used in Life Sciences research. It is an antibody that specifically targets the Nur77 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of Nur77.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC2 antibody, catalog no. 70R-1344</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRABD antibody, catalog no. 70R-3719</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been shown to specifically bind to markers expressed in Mycobacterium tuberculosis strains, leading to inhibition of cell growth. The metabolization process involves various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>

<p>MRPL45 antibody was raised in rabbit using the C terminal of MRPL45 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C5orf35 antibody, catalog no. 70R-4192</p>

<p>CXCL16 antibody was raised in rabbit using highly pure recombinant human CXCL16 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT13 antibody, catalog no. 70R-7449</p>

<p>Rabbit polyclonal Mt22 antibody</p>

<p>SRRP35 antibody was raised using the middle region of Srrp35 corresponding to a region with amino acids RSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSP</p>

<p>Mouse monoclonal PDE4B antibody</p>

<p>ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF</p>

<p>Recombinant Human VEGF165 protein</p>

<p>TTYH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA</p>

<p>ATG4D antibody was raised in rabbit using the middle region of ATG4D as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NXT1 antibody, catalog no. 70R-9292</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD4 antibody, catalog no. 70R-5091</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Recombinant Chikungunya virus Glycoprotein E1 protein - wild type</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rab10 antibody, catalog no. 70R-7844</p>

<p>HYAL1 antibody was raised in rabbit using the N terminal of HYAL1 as the immunogen</p>

<p>The VDAC3 antibody is a highly specialized molecule drug that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications to study the function and localization of the voltage-dependent anion channel 3 (VDAC3). This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>GATA3 antibody was raised in Mouse using a purified recombinant fragment of GATA3(aa175-388) expressed in E. coli as the immunogen.</p>

<p>MTGR1 antibody was raised in Rat using MTGR1 peptide couple to carrier protein as the immunogen.</p>

<p>The HOXB9 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the HOXB9 protein, which plays a crucial role in various cellular processes. This antibody is produced using state-of-the-art techniques and undergoes stringent quality control measures to ensure its efficacy and reliability.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPIon Channel antibody, catalog no. 20R-1185</p>

<p>COX4NB antibody was raised in mouse using recombinant Human Cox4 Neighbor</p>

<p>LCN2 protein is a biomarker that has been extensively studied in the field of Life Sciences. It is involved in various biological processes and has shown potential therapeutic applications. LCN2 protein plays a role in the regulation of iron homeostasis, acting as an iron carrier protein and preventing bacterial growth by sequestering iron. It has also been found to be upregulated in response to inflammation and infection.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHGA antibody, catalog no. 70R-5338</p>

<p>Purified recombinant CRLF2 protein (His tag)</p>

<p>SLC25A35 antibody was raised using the N terminal of SLC25A35 corresponding to a region with amino acids  DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI</p>

<p>Mouse monoclonal LckBP1 antibody</p>

<p>GFP antibody (biotin) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.</p>

<p>CHIT1 antibody was raised in Mouse using a purified recombinant fragment of CHIT1(aa22-137) expressed in E. coli as the immunogen.</p>

<p>SPINT2 antibody was raised in rabbit using the C terminal of SPINT2 as the immunogen</p>