Bioquímicos e reagentes

<p>Delangin B antibody was raised in Rat using Delangin peptide coupled carrier protein as the immunogen.</p>

<p>Mouse monoclonal EXD1 antibody</p>

<p>Rabbit polyclonal p47phox antibody (Ser359)</p>

<p>Desmoplakin 1+2 antibody was raised in mouse using C-terminal polypeptide of recombinant human desmoplakin as the immunogen.</p>

<p>Rabbit polyclonal IREB1 antibody</p>

<p>Mouse monoclonal CD95 Ligand antibody (PE)</p>

<p>The MHC Class II antibody is a monoclonal antibody that specifically targets amyloid protein. It is widely used in Life Sciences research for various applications. This antibody has been extensively validated using techniques such as polymerase chain reaction (PCR), flow cytometry, and clinical plasma samples. The MHC Class II antibody exhibits high specificity and affinity towards its target, making it an ideal tool for studying immune responses and antigen presentation.</p>

<p>Rabbit polyclonal SORT1 antibody</p>

<p>PAR1 antibody is a Polyclonal Antibody used in Life Sciences research. It is designed to target the PAR1 receptor, which plays a crucial role in various physiological processes including coagulation, chemotherapy, and mineralocorticoid signaling. This antibody specifically binds to the extracellular domain of the PAR1 receptor, neutralizing its activity and preventing downstream signaling events. It has been extensively used as a tool in studying the function of PAR1 and its involvement in disease processes. The high specificity and affinity of this antibody make it an ideal choice for researchers looking to investigate the role of PAR1 in different biological systems.</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>The TKT antibody is a potent family kinase inhibitor that targets oncostatin, a protein involved in various cellular processes. This polyclonal antibody is designed to specifically bind to oncostatin and inhibit its activity. It can be used in various life sciences applications, including immunoassays, western blotting, and immunohistochemistry.</p>

<p>CAPS antibody was raised in Rabbit using Human CAPS as the immunogen</p>

<p>ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPG</p>

<p>Benzodiazepines antibody was raised in sheep using benzodiazepine-BSA as the immunogen.</p>

<p>Please enquire for more information about Triazophos-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Recombinant Human RAB39B protein</p>

<p>B3GALTL antibody was raised in Rabbit using Human B3GALTL as the immunogen</p>

<p>Rabbit polyclonal ST8SIA2 antibody</p>

<p>Purified recombinant CYTH3 protein (His tag)</p>

<p>Collagen Type IV antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets collagen, which is a major component of connective tissues in the body. This antibody has been extensively used in research studies to investigate the role of collagen in various biological processes.</p>

<p>Rabbit Polyclonal CLCN4 antibody</p>

<p>The BRAF antibody is a growth factor that is used in the field of life sciences. It belongs to a class of antibodies known as monoclonal antibodies, which are highly specific and targeted. This antibody has cytotoxic properties, meaning it can destroy or inhibit the growth of certain cells. It is commonly used in research and diagnostic applications.</p>

<p>The TSTA3 antibody is a specific antibody that targets nuclear β-catenin, a protein involved in various cellular processes. This antibody has been shown to inhibit the acetylation of β-catenin, which is important for its activation and function. Additionally, the TSTA3 antibody has been found to block the activity of protein kinases involved in signaling pathways regulated by β-catenin. This antibody is widely used in life sciences research to study the role of β-catenin in development, cell proliferation, and differentiation. It has also been used to investigate the effects of various inhibitors and cytokines such as leukemia inhibitory factor, interferon, dopamine, and oncostatin on β-catenin signaling. The TSTA3 antibody is a valuable tool for researchers studying these processes in both normal and diseased tissues.</p>

<p>CASC3 antibody was raised in Rabbit using Human CASC3 as the immunogen</p>

<p>LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM</p>

<p>Mouse monoclonal Myosin antibody</p>

<p>Upf1/Rent1 (pThr28) Antibody</p>

<p>Mouse monoclonal OMP28 antibody</p>

<p>Crystallin Mu antibody was raised using the middle region of CRYM corresponding to a region with amino acids AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA</p>

<p>KIR2D antibody was raised in mouse using recombinant human kIR2D (44-202aa) purified from E. coli as the immunogen.</p>

<p>BTG4 antibody was raised in Rabbit using Human BTG4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF284 antibody, catalog no. 70R-8896</p>

<p>Rabbit polyclonal Galectin 7 antibody</p>

<p>GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH</p>

<p>Rabbit polyclonal ARFGAP1 antibody</p>

<p>Purified recombinant PEX26 protein (His tag)</p>

<p>BBX antibody was raised in rabbit using the middle region of BBX as the immunogen</p>

<p>Rabbit Polyclonal NFkB p65 antibody (Thr505)</p>

<p>Insulin protein is a vital hormone that plays a crucial role in regulating blood sugar levels. It acts as an oncogene homolog and growth factor, promoting cell growth and development. Insulin is responsible for the uptake of glucose into cells, where it is used for energy production. Additionally, insulin has methylating properties and can regulate insulin secretory function and β-cell proliferation.</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>The MMAB antibody is a glycoprotein that plays a crucial role in pluripotent stem cell differentiation. It acts as an activator of dopamine and acetylcholine, which are important neurotransmitters involved in various physiological processes. The MMAB antibody can be used as a serum marker to detect the presence of certain diseases and monitor their progression.</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>SLC12A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG</p>

<p>The NOTCH2 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists studying the NOTCH2 protein and its role in various biological processes. This antibody is designed to specifically target and neutralize the NOTCH2 protein, allowing for detailed analysis and investigation.</p>

<p>Rabbit polyclonal CAPN9 antibody</p>

<p>DUT antibody was raised using the N terminal of DUT corresponding to a region with amino acids AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK</p>

<p>Peptide H-ALVDQVIGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>IL7 antibody was raised in rabbit using highly pure recombinant murine IL-7 as the immunogen.</p>

<p>ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV</p>

<p>Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE</p>