Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.127 produtos)
- Por Alvo Biológico(99.160 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.742 produtos)
- Metabólitos secundários(14.222 produtos)
Foram encontrados 130581 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Goat anti Mouse IgG + IgM (HRP)
<p>Goat anti-Mouse IgG + IgM (HRP) was raised in goat using purified Mouse IgG + IgM as the immunogen.</p>RC3H2 antibody
<p>RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR</p>ALS2CR12 antibody
<p>ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP</p>VU 0361737
CAS:<p>VU 0361737 is a small molecule that has been shown to have anti-inflammatory properties. It binds to glutamate receptors, which are involved in the regulation of inflammatory responses and pain. VU 0361737 also blocks microglia activation, prevents glutamate toxicity, and inhibits tumor progression in a mouse model of melanoma. It was also found to be neuroprotective against glutamate-induced neurotoxicity in primary hippocampal neurons and cerebellar granule cells. The molecular mode of action of VU 0361737 is not completely understood, but it may be due to its ability to block the adenosine receptor A2A signaling pathway.</p>Fórmula:C13H11ClN2O2Pureza:Min. 95%Peso molecular:262.69 g/molBAX antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>Pureza:Min. 95%IL1b antibody
<p>IL1b antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. IL-1β plays a crucial role in the regulation of immune responses, cell growth, and differentiation. This antibody has been extensively used in research and life sciences to study the function of IL-1β and its inhibitors.</p>SRD5A2 antibody
<p>SRD5A2 antibody was raised using the N terminal of SRD5A2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR</p>Pureza:Min. 95%CDK5 antibody
<p>The CDK5 antibody is a highly specialized monoclonal antibody that has neutralizing properties against cyclin-dependent kinase 5 (CDK5). CDK5 is an enzyme involved in various cellular processes, including cell cycle regulation and neuronal development. The CDK5 antibody acts as an inhibitor of CDK5 activity, leading to cytotoxic effects on targeted cells.</p>HMN-176
CAS:<p>HMN-176 is a synthetic antifungal compound, which is an indolocarbazole derivative sourced from a natural alkaloid framework. This product exhibits its mode of action by inhibiting fungal cell division, specifically through interference with microtubule polymerization. This mechanism effectively disrupts the mitotic process, leading to cell cycle arrest and subsequent fungal cell death.</p>Fórmula:C20H18N2O4SPureza:Min. 95%Peso molecular:382.43 g/molCytokeratin antibody cocktail
<p>The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.</p>TMTC4 antibody
<p>TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF</p>Pureza:Min. 95%TIMM10 antibody
<p>The TIMM10 antibody is a polyclonal antibody that specifically targets the TIMM10 protein. This protein is located in the mitochondria and plays a crucial role in various cellular processes, including hormone and growth factor signaling, as well as β-catenin stabilization. The TIMM10 antibody binds to the amino-terminal region of the protein, allowing for its detection and analysis in biological samples.</p>PAX6 antibody
<p>PAX6 antibody was raised in Mouse using a purified recombinant fragment of human PAX6 expressed in E. coli as the immunogen.</p>CMP 98
CAS:<p>Negative control for CM11; no effect on VHL E3 ubiquitin ligase</p>Fórmula:C58H82N8O14S2Pureza:Min. 95%Peso molecular:1,179.45 g/molCAV1 antibody
<p>The CAV1 antibody is a growth factor that has multidrug and interferon properties. It is widely used in the field of Life Sciences for its neuroprotective effects. This antibody specifically targets vasoactive intestinal peptide (VIP) binding proteins, which play a crucial role in various cellular processes. The CAV1 antibody can be used in research studies to detect and measure the levels of VIP binding proteins in samples. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The low-molecular-weight nature of this antibody allows for efficient penetration into cells, ensuring accurate detection and analysis. Additionally, the CAV1 antibody has been shown to possess neutralizing activity against certain factors, making it a valuable tool in various experimental settings. Researchers can rely on the high-quality performance of this antibody to obtain reliable and reproducible results for their studies.</p>Pureza:Min. 95%HDAC3 antibody
<p>The HDAC3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect HDAC3, a protein involved in various cellular processes. This antibody has been extensively validated and proven to be highly specific and sensitive in detecting HDAC3 levels.</p>ZNF511 antibody
<p>ZNF511 antibody was raised in rabbit using the N terminal of ZNF511 as the immunogen</p>Pureza:Min. 95%Dopamine Receptor D1 antibody
<p>The Dopamine Receptor D1 antibody is a monoclonal antibody that specifically targets the dopamine receptor D1. It has been shown to have neutralizing properties and can be used for various applications in research and diagnostics. This antibody has been tested on different cell lines, including MCF-7 carcinoma cell lines, and has demonstrated its effectiveness in blocking the binding of dopamine to its receptor. The use of this antibody can help researchers better understand the role of dopamine receptors in various physiological processes and diseases. It can also be used in immunoassays, such as ELISA or Western blotting, to detect the presence of dopamine receptor D1 in biological samples. With its high specificity and sensitivity, this antibody is a valuable tool for studying dopamine signaling pathways and exploring potential therapeutic interventions targeting this receptor.</p>PINX1 antibody
<p>PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF</p>Frizzled antibody
<p>Frizzled antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%Visfatin antibody
<p>Visfatin antibody was raised in mouse using recombinant human Visfatin (1-491aa) purified from E. coli as the immunogen.</p>EPHX1 antibody
<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG</p>Pureza:Min. 95%ODF3L1 antibody
<p>ODF3L1 antibody was raised using the N terminal of ODF3L1 corresponding to a region with amino acids KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC</p>MBOAT1 antibody
<p>MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR</p>Influenza B antibody (FITC)
<p>Influenza B antibody (FITC) was raised in mouse using am Infuenze B nuclear protein as the immunogen.</p>
