Bioquímicos e reagentes

<p>The ITGA5 antibody is a growth factor antibody that plays a crucial role in the field of Life Sciences. It specifically targets and neutralizes interleukin-6 (IL-6), an important cytokine involved in various physiological processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is highly active in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, demonstrating its high efficacy. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Vimentin antibody was raised using the N terminal of VIM corresponding to a region with amino acids LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX49 antibody, catalog no. 70R-1308</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP91 antibody, catalog no. 20R-1106</p>

<p>DNAI2 antibody was raised in rabbit using the N terminal of DNAI2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RTN4 antibody, catalog no. 70R-7137</p>

<p>Purified recombinant MYLPF protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMPO antibody, catalog no. 70R-6298</p>

<p>The KLK2 antibody is a monoclonal antibody that specifically targets the KLK2 protein in human serum. This antibody has been extensively studied and characterized using various techniques, such as molecular docking and polymerase chain reaction (PCR). It has shown high specificity and affinity for the KLK2 protein, making it an ideal tool for research in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KREMEN1 antibody, catalog no. 70R-6267</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MIS12 antibody, catalog no. 70R-5558</p>

<p>E2f7 antibody was raised in rabbit using the N terminal of E2F7 as the immunogen</p>

<p>Purified recombinant ATP1B3 protein (His tag)</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. It belongs to the group of Polyclonal Antibodies and has cytotoxic properties. This antibody specifically targets AKT1, a protein involved in various cellular processes such as cell growth, proliferation, and survival. By binding to AKT1, this antibody inhibits its activity and prevents downstream signaling pathways from being activated.</p>

<p>The GCF antibody is a growth factor that belongs to the family of monoclonal antibodies. It has been shown to inhibit the activity of various proteins involved in cell growth, including adalimumab, anti-VEGF, and trastuzumab. The GCF antibody has been extensively studied in the field of life sciences and has demonstrated its effectiveness in inhibiting the growth of various cell types, including MCF-7 and endothelial cells. This antibody can be used as a research tool for studying protein interactions and signaling pathways related to cell growth. Additionally, it has shown potential therapeutic applications in targeting specific proteins, such as keratinocyte growth factor and CD33. With its versatile properties and wide range of applications, the GCF antibody is a valuable tool for researchers in various fields.</p>

<p>ML291 is a chemical compound that functions as an investigative antimicrobial agent, which is synthesized through intricate organic chemistry processes to yield a distinct molecular structure. Its mode of action involves disrupting bacterial metabolic pathways, leading to the inhibition of essential enzymatic functions. By targeting specific cellular processes, ML291 effectively impedes the growth of various bacterial strains.</p>

<p>Affinity purified Rabbit polyclonal Prohibitin 2 antibody</p>

<p>ABI1 antibody was raised in Rabbit using Human ABI1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN2 antibody, catalog no. 70R-7314</p>

<p>The gamma Tubulin antibody is a powerful tool used in Life Sciences research. It is a mouse monoclonal antibody that specifically targets gamma Tubulin, a protein involved in the organization of microtubules and centrosome function. This antibody has been extensively validated for use in various applications, including immunofluorescence, immunohistochemistry, and western blotting.</p>

<p>ST6GALNAC3 antibody was raised using the C terminal of ST6GALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT</p>

<p>Rabbit polyclonal ZIC1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits bactericidal activity against mycobacterium strains. It achieves this by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The CD62P antibody is a monoclonal antibody that acts as an inhibitor. It has been shown to prevent hemolysis and inhibit the growth factor in adipose tissue. Additionally, this antibody has demonstrated potential in reducing amyloid plaque formation and targeting activated proteins. It also exhibits cytotoxic effects on Mycoplasma genitalium. The CD62P antibody belongs to the group of Monoclonal Antibodies and is effective against autoantibodies, particularly those targeting annexin.</p>

<p>PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI</p>

<p>NXNL2 antibody was raised using the middle region of NXNL2 corresponding to a region with amino acids SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC</p>

<p>SPA17 antibody was raised in rabbit using the N terminal of SPA17 as the immunogen</p>

<p>Purified Rabbit polyclonal OXER1 antibody</p>

<p>Affinity purified Rabbit polyclonal TEAD4 antibody</p>

<p>Mouse monoclonal MRPS25 antibody</p>

<p>Abcc2 antibody was raised in rabbit using the middle region of Abcc2 as the immunogen</p>

<p>The SERPINA1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes the activity of SERPINA1, an important protein involved in adipose tissue regulation. This antibody has been shown to have cytotoxic effects on adipocytes, leading to a reduction in adipose tissue mass. Additionally, it has been found to modulate the levels of various hormones such as androgen, dopamine, glucagon, and growth factors. The SERPINA1 antibody is a valuable tool for researchers studying the molecular mechanisms underlying adipose tissue function and regulation. With its high specificity and potency, this monoclonal antibody offers great potential for therapeutic applications in the future.</p>

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB8 antibody, catalog no. 70R-6177</p>

<p>The PAK2 antibody is a monoclonal antibody that has antiviral properties. It specifically targets and binds to PAK2, a protein involved in various cellular processes such as cell migration, proliferation, and survival. This antibody can be used for research purposes in the field of Life Sciences to study the role of PAK2 in different biological pathways.</p>

<p>MGAT4C antibody was raised in Rabbit using Human MGAT4C as the immunogen</p>

<p>Rabbit Polyclonal SHP2 antibody (Tyr542)</p>

<p>The CXCR3 antibody is a monoclonal antibody that targets the CXCR3 chemokine receptor, a crucial molecule involved in cell growth and migration. This antibody is widely used in Life Sciences research to study the role of CXCR3 in various biological processes. It has been shown to be effective in neutralizing the activity of CXCR3 and blocking its interaction with its ligands. The CXCR3 antibody has also been used in studies on pleomorphic adenoma, where it was found to inhibit the collagenase activity of this tumor. This monoclonal antibody is available as both a test substance and for research purposes. It can be conjugated with magnetic particles for easy purification or detection. Whether you are studying chemokine signaling or investigating the function of CXCR3, this antibody is an essential tool for your research.</p>

<p>SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA</p>

<p>SRA1 antibody was raised in rabbit using the middle region of SRA1 as the immunogen</p>

<p>Rabbit anti-cat IgG (Rhodamine) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>UNCX antibody was raised in rabbit using the C terminal of UNCX as the immunogen</p>

<p>EPS8 antibody was raised using the middle region of EPS8 corresponding to a region with amino acids VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH</p>

<p>The BMX antibody is a powerful tool for researchers in the field of molecular biology. It is an antibody that specifically targets and binds to the BMX protein, a member of the tyrosine kinase family. This antibody can be used in various applications, such as Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>CLDN11 antibody was raised in Rabbit using Human CLDN11 as the immunogen</p>

<p>Rabbit polyclonal Cyclin D3 antibody (Thr283)</p>

<p>Mouse monoclonal Influenza A H1N1 HA1 antibody</p>