Bioquímicos e reagentes

<p>Sheep polyclonal Hydromorphone antibody</p>

<p>SDSL antibody was raised using the N terminal of SDSL corresponding to a region with amino acids MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR</p>

<p>The MIT protein, also known as alpha-galactose antigen, is a highly versatile and potent antibody-drug that has various applications in the field of Life Sciences. This monoclonal antibody specifically targets and binds to the alpha-gal epitope, which is present on a wide range of native proteins and antigens. It can be immobilized for use in assays or purification processes, making it an essential tool for researchers.</p>

<p>PDE7A Antibody</p>

<p>195-308 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMARA RNGDHCPLGP GRCCRLHTVR ASLEDLGWAD WVLSPREVQV TMCIGACPSQ FRAANMHAQI KTSLHRLKPD TVPAPCCVPA SYNPMVLIQK TDTGVSLQTY DDLLAKDCHC I</p>

<p>GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI</p>

<p>Rabbit polyclonal ZNF480 antibody</p>

<p>Mouse monoclonal MHC Class I H2Kk antibody (biotin)</p>

<p>Pura antibody was raised in rabbit using the C terminal of Pura as the immunogen</p>

<p>Purified recombinant DCTN2 protein (His tag)</p>

<p>Purified Polyclonal CREG1 antibody</p>

<p>Hemopexin antibody was raised against Human Hemopexin.</p>

<p>Rabbit polyclonal CRGF antibody (biotin)</p>

<p>Purified recombinant PCMTD1 protein (His tag)</p>

<p>The RHBDD1 antibody is a monoclonal antibody specifically designed to target insulin. It is commonly used in research and diagnostic applications for the detection and analysis of insulin levels. This antibody has been extensively validated using mass spectrometry methods and has shown high specificity and sensitivity in detecting insulin in various samples, including human serum. The RHBDD1 antibody is derived from a hybridoma cell line and is produced using recombinant human insulin as an antigen. Its unique binding properties enable accurate measurement of insulin levels, making it an essential tool in the field of Life Sciences. Whether you are studying hyperinsulinaemic hypoglycaemia or investigating insulin-related disorders, this mouse monoclonal antibody can provide reliable results. With its ability to recognize specific acid residues on insulin, the RHBDD1 antibody offers precise and consistent performance for insulin detection. Trust this high-quality antibody for your research needs and unlock new insights into the role of insulin in various physiological processes.</p>

<p>RAD17 antibody was raised in rabbit using residues 10-23 [STKRSLKKKKIRKI] of the S. pombe RAD17 75 kDA protein as the immunogen.</p>

<p>Rabbit polyclonal SERPINA10 antibody</p>

<p>PTPMT1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ZNF19 antibody was raised using the N terminal of ZNF19 corresponding to a region with amino acids TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE</p>

<p>Rabbit polyclonal CHOP antibody (Ser30)</p>

<p>Rabbit Polyclonal STAM2 antibody</p>

<p>The NGAL antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly employed in transfer reactions and immunoassays to detect and quantify NGAL (neutrophil gelatinase-associated lipocalin) levels in various biological samples. This antibody has also been investigated as a potential therapeutic agent, particularly as an anti-CD25 antibody drug for targeted therapy.</p>

<p>LCOR antibody was raised in rabbit using the C terminal of LCOR as the immunogen</p>

<p>NR4A3 antibody was raised using the middle region of NR4A3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN</p>

<p>UBE2L3 antibody was raised using the middle region of UBE2L3 corresponding to a region with amino acids WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQ</p>

<p>Rabbit polyclonal TPPP3 antibody</p>

<p>AMG PERK 44 is a cytosolic calcium ionophore that activates the phosphorylation of eukaryotic protein kinase C. It acts through a biomimetic mechanism to increase Ca2+ concentrations in cells, which leads to increased protein synthesis, autophagy, and cell death. AMG PERK 44 has been shown to be effective against cancer cells and HIV-infected lymphocytes. It has also been shown to inhibit the growth of human immunodeficiency virus (HIV) infected cells by targeting the endoplasmic reticulum and increasing the levels of cytoplasmic Ca2+.</p>

<p>Purified recombinant RETN protein (His tag)</p>

<p>NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN</p>

<p>Goat anti-human IgG Fc (biotin) was raised in goat using human igG, Fc fragment as the immunogen.</p>

<p>RPL3 antibody was raised using the N terminal of RPL3 corresponding to a region with amino acids DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMV</p>

<p>Mouse monoclonal UBL4A antibody</p>

<p>HCV antibody was raised in rabbit using residues 33-43 [CGVYLLPRRGPR] of HCV core, env, and part of E2/NS1 of HCV as the immunogen.</p>

<p>C10ORF57 antibody was raised using the middle region of C10Orf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH</p>

<p>HNRNPK antibody was raised in Rabbit using Human HNRNPK as the immunogen</p>

<p>CA13 protein is a conjugated protein that plays a role in various biological processes. It has been found to affect viscosity and antibody production. In particular, CA13 protein has been shown to inhibit interleukin-6 (IL-6), an inflammatory cytokine involved in immune responses. Studies have demonstrated its inhibitory factor on hemolysis and its potential applications in the field of Life Sciences. Monoclonal antibodies targeting CA13 protein have been developed for research purposes, allowing for the detection and neutralization of this protein in blood serum samples. Additionally, CA13 protein has been investigated for its impact on potassium levels in human serum and its interaction with recombinant viruses. Further research is being conducted to explore the potential therapeutic uses of CA13 protein in various diseases, including those related to TNF-α signaling pathways.</p>

<p>The Beta Amyloid antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody is specifically designed to target and bind to beta amyloid, a protein that plays a crucial role in the development and progression of Alzheimer's disease. By binding to beta amyloid, this antibody inhibits its aggregation and promotes its clearance from the brain.</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>KLHL18 antibody was raised in Rabbit using Human KLHL18 as the immunogen</p>

<p>PAI1 antibody was raised in rabbit using highly pure recombinant human PAI-1 as the immunogen.</p>

<p>Rabbit polyclonal RPS20 antibody</p>

<p>Clostridium difficile Toxin B protein is a potent protein that plays a crucial role in the pathogenesis of Clostridium difficile infection. It is involved in disrupting the integrity of the intestinal epithelial barrier and causing severe inflammation. The toxin binds to specific receptors on the cell surface, leading to the activation of various signaling pathways and the release of pro-inflammatory cytokines such as interleukin-6.</p>

<p>Purified recombinant SCN3B protein (His tag)</p>

<p>The EFNB2 antibody is a medicinal product that falls under the category of Life Sciences. It is an antibody that specifically targets and inhibits the activity of EFNB2 protein. This antibody is known as a polyclonal antibody, meaning it is derived from multiple sources and can recognize different epitopes on the target protein. The EFNB2 antibody has been extensively studied and proven to be effective in various research applications within the field of Life Sciences. Its high specificity and affinity make it a valuable tool for scientists and researchers working in this area. With its ability to selectively bind to EFNB2 protein, this antibody opens up new possibilities for understanding its role in biological processes and developing therapeutic interventions.</p>

<p>Mouse monoclonal Morphine 3 antibody</p>

<p>The Cathepsin G antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It offers exceptional photostability and cytotoxic properties, making it ideal for various research applications. This antibody targets the cycloalkyl group found in growth factors and polymerase enzymes, including EGF-like proteins.</p>

<p>Rabbit polyclonal HNRPLL antibody</p>

<p>The CD105 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to CD105, also known as endoglin. CD105 is a cell surface glycoprotein that plays a crucial role in angiogenesis and vascular development. This antibody can be used in various immunoassays, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Rabbit polyclonal PGDH3 antibody (FITC)</p>