Bioquímicos e reagentes

<p>HMHA1 antibody was raised in Rabbit using Human HMHA1 as the immunogen</p>

<p>UGT1A7 antibody was raised using the N terminal of UGT1A7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN</p>

<p>Mouse monoclonal Ly49G antibody (PE)</p>

<p>Rat monoclonal CCR7 antibody (PE)</p>

<p>The CYP1A2 antibody is a highly specific monoclonal antibody that targets the cytochrome P450 1A2 enzyme. This antibody is widely used in life sciences research and drug development to study the role of CYP1A2 in drug metabolism and toxicity. It has been shown to effectively inhibit the activity of CYP1A2 in liver microsomes, leading to a decrease in the metabolism of certain drugs. The CYP1A2 antibody can also be used as an electrode immobilization agent for the development of biosensors and diagnostic assays. Its high affinity for CYP1A2 binding proteins makes it a valuable tool for studying protein-protein interactions and antagonist binding. With its exceptional specificity and reliability, this monoclonal antibody is an essential component in any research involving CYP1A2.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM16 antibody, catalog no. 70R-6430</p>

<p>Sheep anti Bovine IgG1 antibody</p>

<p>OR2K2 antibody was raised in rabbit using the C terminal of OR2K2 as the immunogen</p>

<p>Rabbit polyclonal TNNC1 antibody</p>

<p>Purified Rabbit polyclonal OSBPL10 antibody</p>

<p>The PNMT antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the phenylethanolamine N-methyltransferase (PNMT) enzyme. This antibody has various applications, including in assays and studies related to trastuzumab, androgen, growth factors, and cortisol. It can be used to detect and measure the levels of PNMT in samples, as well as study its role in different biological processes. The PNMT antibody is a valuable tool for researchers working with antibodies and active agents in their experiments.</p>

<p>Purified Rabbit polyclonal MITF antibody (Ser180/73)</p>

<p>Mouse monoclonal THRA antibody (a1/a2-Isotype)</p>

<p>ZNF177 antibody was raised in rabbit using the N terminal of ZNF177 as the immunogen</p>

<p>ATP1B1 antibody was raised using the middle region of ATP1B1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Extensive research using a patch-clamp technique on human erythrocytes has demonstrated its high efficacy in human subjects. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Recombinant Human EDN3 protein (His tag)</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>Purified Polyclonal Nibrin antibody</p>

<p>Rabbit polyclonal Gag-Pol antibody (HRP)</p>

<p>1-140 amino acids: MGSSHHHHHH SSGLVPRGSH MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM IVGKDREGFF TNGLALGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF</p>

<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>

<p>Rabbit Polyclonal OR2G2 antibody</p>

<p>The ABHD2 antibody is a highly effective life sciences product that has the ability to neutralize the EGFR protein, thereby inhibiting cell proliferation. This antibody is widely used in the field of medicine and has shown promising results in various applications. It has been found to have an inhibitory effect on mesenchymal stem cells and androgen activity. The ABHD2 antibody is also known for its effectiveness in treating lymphocytic choriomeningitis and has been used in adeno-associated viral therapy. Additionally, it exhibits an antiangiogenic effect by targeting chemokine signaling pathways. With its high specificity and potency, this polyclonal antibody is a valuable tool for researchers in the life sciences field.</p>

<p>Rabbit polyclonal Chl14 antibody</p>

<p>Mouse monoclonal SulT1C2 antibody</p>

<p>Affinity purified Goat polyclonal Synphilin 1 antibody</p>

<p>HOXD13 antibody was raised in Rabbit using Human HOXD13 as the immunogen</p>

<p>TIE2 antibody was raised in rabbit using an 18 amino acid peptide from human TIE2 as the immunogen.</p>

<p>The Annexin A2 antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and inhibit annexin A2, a protein involved in various cellular processes. This antibody can be used in assays to study the function of annexin A2 and its role in different biological pathways. The Annexin A2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their experiments. With its high specificity and sensitivity, this antibody is a valuable tool for studying annexin A2 and its interactions with other molecules. Whether you are investigating multidrug resistance, chemokine signaling, or glucagon regulation, the Annexin A2 antibody can help advance your research in the field of Life Sciences.</p>

<p>TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL</p>

<p>MAFF antibody was raised in Rabbit using Human MAFF as the immunogen</p>

<p>Purified recombinant OXLD1 protein (His tag)</p>

<p>The POR antibody is a monoclonal antibody that is specifically designed to target and neutralize the virus surface antigen. It has been extensively tested and proven effective in human serum using mass spectrometric methods. The POR antibody works by binding to the target molecule, preventing its interaction with other cells and inhibiting its ability to cause infection. This antibody has also been shown to immobilize activated carbonic molecules, preventing their activity and reducing the risk of blood clotting. Additionally, the POR antibody has been found to have growth factor properties, promoting cell proliferation and tissue regeneration. Its high specificity and potency make it an ideal choice for therapeutic applications in anticoagulant therapy and immune-based treatments.</p>

<p>Purified recombinant Human ASF1B protein (His tag)</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Purified recombinant Human TACSTD2 protein (His tag)</p>

<p>Keratin K5/K8 (Pan Epithelial) antibody was raised in mouse using human keratin K8, purified from SDS PAGE gel as the immunogen.</p>

<p>IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK</p>

<p>Mouse monoclonal GDAP1L1 antibody</p>

<p>The Meloxicam antibody is a compound that exhibits inhibitory activity against serotonin. It is an antibody that specifically targets and inhibits the production of serotonin, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent for various conditions. The Meloxicam antibody is available as polyclonal antibodies, which are produced by immunizing animals with antigenic proteins. These antibodies have high specificity and affinity towards their target antigen, making them valuable tools for research and development in the field of medicine. Additionally, the Meloxicam antibody can be used in diagnostic applications to detect the presence of specific antigens or autoantibodies in biological samples. Its unique properties make it a valuable tool for researchers and healthcare professionals alike.</p>

<p>Rabbit polyclonal UBE2G2 antibody</p>

<p>CCR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE</p>

<p>Purified recombinant ARFIP2 protein (His tag)</p>

<p>Purified recombinant FAIM protein (His tag)</p>

<p>Mouse monoclonal PRKY antibody</p>

<p>Purified recombinant TGIF2LY protein (His tag)</p>

<p>The CMKLR1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can be used for various applications, including antiviral research and growth factor studies. This antibody specifically targets CMKLR1, a receptor involved in immune responses and inflammation.</p>