Bioquímicos e reagentes

<p>Rabbit polyclonal CK1 alpha antibody (Tyr294)</p>

<p>Purified Polyclonal RGS17 antibody</p>

<p>Akt, or Protein Kinase B (PKB), is a kinase crucial for cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to external signals like growth factors. Activated through phosphorylation at specific sites, Akt influences key cellular processes by promoting cell survival, aiding protein synthesis through mTOR activation, regulating glucose metabolism, and supporting blood vessel formation and cell movement. Its hyperactivation is common in cancers, making it a target for cancer therapies, while its role in glucose regulation links it to insulin resistance and type 2 diabetes.</p>

<p>PLAT antibody is a test compound used to detect the presence of autoantibodies in samples. These autoantibodies are antibodies that target and attack the body's own tissues or cells. The PLAT antibody can be used in various assays and experiments to study the role of these autoantibodies in different diseases and conditions.</p>

<p>GPR160 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>DMBX1 antibody was raised in rabbit using the middle region of DMBX1 as the immunogen</p>

<p>The Histone H2B antibody is a valuable tool in Life Sciences research. This polyclonal antibody specifically targets Histone H2B, a protein involved in DNA packaging and gene regulation. It has high affinity for Histone H2B and shows minimal cross-reactivity with other proteins.</p>

<p>The Smad3 antibody is a polyclonal antibody that specifically targets the growth hormone receptor. It is commonly used in life sciences research to study the activation of various signaling pathways. This antibody has been shown to neutralize the effects of progesterone, dopamine, and chemokines by binding to their respective receptors. The Smad3 antibody can be used in various experimental techniques such as immunohistochemistry, Western blotting, and ELISA. It is produced using high-quality excipients and undergoes rigorous quality control measures to ensure its efficacy and specificity. With its ability to detect and inhibit specific proteins, the Smad3 antibody is an invaluable tool for researchers in the field of molecular biology.</p>

<p>Rabbit polyclonal RBP4 antibody (biotin)</p>

<p>Rabbit polyclonal PDGFB antibody</p>

<p>Cofilin 1 antibody was raised in mouse using recombinant human Cofilin 1 (1-166aa) purified from E. coli as the immunogen.</p>

<p>Purified native Human Lactoferrin protein</p>

<p>Purified native Theiler's Murine Encephalomyelitis virus protein</p>

<p>Mouse monoclonal Cytokeratin 8+18 antibody (Prediluted for IHC)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Additionally, it has been shown to have a high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN</p>

<p>Mouse monoclonal Vibrio cholerae O1 Ogawa antibody</p>

<p>Notch 4 homolog antibody was raised in rabbit using a synthetic peptide representing an internal region of the human NOTCH homolog 4 (NOTCH4) protein as the immunogen.</p>

<p>Bovine Red Blood Cells are a vital component in the field of Life Sciences and have various applications, especially in Veterinary Applications. These cells can be used as a fluorophore for imaging studies and other research purposes. The emission properties of Bovine Red Blood Cells make them suitable for use in fluorescence-based assays.</p>

<p>High affinity probe for glucose transporter; photoaffinity label</p>

<p>Rabbit polyclonal LEF1 antibody (Ser42)</p>

<p>Purified recombinant NXPH1 protein (His tag)</p>

<p>HNRNPC antibody was raised in Rabbit using Human HNRNPC as the immunogen</p>

<p>G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM</p>

<p>CLAN antibody was raised in rabbit using N terminus sequence MNFIKDNSRA LIQRMGM of the A and B isoforms of the human CLAN protein as the immunogen.</p>

<p>Il6 protein is an inhibitory factor that belongs to the group of proteins and antigens. It can be used in combination with adalimumab or other inhibitors for therapeutic purposes. Il6 protein has been shown to have chemokine and epidermal growth factor properties, as well as anti-VEGF (vascular endothelial growth factor) and neutralizing effects on TNF-α (tumor necrosis factor-alpha). It also exhibits activity against interleukins and interferons. Additionally, Il6 protein has carbonic properties and can be used in conjugated proteins for various applications, including the treatment of endothelial growth disorders.</p>

<p>Purified Polyclonal EDG3 antibody</p>

<p>Recombinant Human PICK1 protein (His tag)</p>

<p>Purified recombinant GDI2 protein (His tag)</p>

<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFV</p>

<p>SOX12 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 12</p>

<p>The Cytochrome P450 2D6 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize the activity of the Cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism and can affect the efficacy and safety of various medications.</p>

<p>MRPL28 antibody was raised in Rabbit using Human MRPL28 as the immunogen</p>

<p>Rabbit polyclonal SEC61A1 antibody</p>

<p>Rabbit Polyclonal OR2A7 antibody</p>

<p>ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV</p>

<p>AD80 is a multi-kinase inhibitor that prevents the phosphorylation and activation of tyrosine kinases. It has been shown to inhibit the proliferation of leukemia cells in vivo. AD80 has been found to be effective against glioblastoma cells and other cancer types, such as melanoma, breast cancer, and lung cancer. AD80 inhibits protein synthesis by binding to the ATP-binding site of the enzyme kinase domain. The solubility data for AD80 shows that it is highly soluble in water and organic solvents.</p>

<p>Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>Purified Polyclonal CACNG1 antibody</p>

<p>BRCA2 (pSer3291)</p>

<p>Amyloid P-IN-1 is a ligand that binds to the amyloid peptide and inhibits the formation of amyloids. Amyloid P-IN-1 has been shown to be an orally active molecule in humans, with a low oral bioavailability due to its physicochemical properties. The affinity for amyloid P-IN-1 to bind to the amyloid peptide is high and it has been shown to inhibit the growth of amyloids in vitro and in vivo. Amyloid P-IN-1 also has pharmacological effects on ligands, such as binding to receptors on cells, which may account for its potential use as a therapeutic agent.</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR</p>

<p>WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids TKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQW</p>

<p>MSTN antibody was raised in Rabbit using Human MSTN as the immunogen</p>

<p>Rabbit polyclonal TPH2 antibody (Ser58)</p>

<p>Rabbit polyclonal VEGFC antibody (FITC)</p>

<p>LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS</p>

<p>Mouse monoclonal RIT2 antibody</p>