Bioquímicos e reagentes

<p>Recombinant Human PEPD protein (His tag)</p>

<p>Guanethidine Monosulfate (USP grade powder) chemical reference substance</p>

<p>AKAP8 antibody was raised in rabbit using the middle region of AKAP8 as the immunogen</p>

<p>Rat anti Mouse IgG3 is a secondary antibody that is used in various research applications. It specifically targets mouse IgG3 antibodies and can be used for detection, quantification, and purification purposes. This antibody has been extensively tested and validated for its specificity and sensitivity. It is commonly used in immunology, life sciences, and biomedical research. Rat anti Mouse IgG3 has shown excellent performance in assays such as ELISA, western blotting, immunohistochemistry, flow cytometry, and more. With its high affinity and low cross-reactivity, this antibody ensures accurate and reliable results in your experiments. Trust Rat anti Mouse IgG3 to enhance the efficiency and accuracy of your research in the field of Life Sciences.</p>

<p>The CREB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically target and bind to activated CREB (cAMP response element-binding protein), a key regulator of gene expression. This antibody has been extensively tested and validated for its receptor binding efficacy.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CASP1 antibody, catalog no. 70R-9648</p>

<p>Mouse monoclonal FABP2 antibody</p>

<p>Purified Rabbit polyclonal OR10K1 antibody</p>

<p>The CD38 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD38, a protein found on the surface of various cells. This antibody has multiple applications, including research in insulin signaling, electrode development, and drug delivery systems.</p>

<p>SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS</p>

<p>The TAU antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to TAU, a protein involved in various cellular processes. This polyclonal antibody has been extensively studied and proven to be highly effective in research applications.</p>

<p>Rabbit polyclonal WRNIP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NRG1 antibody, catalog no. 70R-6239</p>

<p>Rabbit polyclonal RPL23A antibody</p>

<p>FKBP10 antibody was raised in Rabbit using Human FKBP10 as the immunogen</p>

<p>The CYP2C9 antibody is a growth factor that plays a crucial role in various cellular processes. It acts as a phosphatase, regulating the transfer reactions within cells. This monoclonal antibody is specifically designed to target and bind to CYP2C9, ensuring accurate and reliable results in immunoassays.</p>

<p>Rabbit polyclonal SEMG1 antibody</p>

<p>Rabbit polyclonal OSTF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT6 antibody, catalog no. 70R-7182</p>

<p>LITAF antibody was raised in mouse using recombinant human LITAF (1-161aa) purified from E. coli as the immunogen.</p>

<p>CD18 antibody was raised in hamster using beta-2 integrin (CD18) as the immunogen.</p>

<p>MOG antibody was raised in Rabbit using Human MOG as the immunogen</p>

<p>FABP2 antibody was raised in Mouse using a purified recombinant fragment of human FABP2 expressed in E. coli as the immunogen.</p>

<p>The PRMT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to PRMT1, a protein involved in various cellular processes. This antibody has been extensively tested and validated for use in immunoassays, making it an essential tool for researchers studying the function and regulation of PRMT1.</p>

<p>COL1A2 antibody was raised in Rabbit using Human COL1A2 as the immunogen</p>

<p>BTN2A2 antibody was raised in Rabbit using Human BTN2A2 as the immunogen</p>

<p>The p47 phox antibody is a primary amino acid that belongs to the class of polyclonal antibodies. It is commonly used in Life Sciences research, particularly in the study of mucopolysaccharidosis type and natriuretic factors. This antibody can be used as a tool to detect and quantify p47 phox protein levels in various biological samples, such as human serum or cell lysates. The p47 phox antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their specific experimental needs. Its high specificity and sensitivity make it an ideal choice for studies involving oncostatin M (OSM) signaling pathways, messenger RNA expression analysis, or protein-protein interactions with acidic proteins like casein or inhibitory factors.</p>

<p>Mouse monoclonal NAPEPLD antibody</p>

<p>The mTOR antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of antibodies and specifically falls under the classification of anti-idiotypic antibodies. This antibody is designed to target and bind to activated glycoproteins involved in various cellular processes.</p>

<p>Rabbit polyclonal ATBP3 antibody</p>

<p>The EPCAM antibody is a highly effective monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EPCAM). It has a high affinity for the antigen binding domain and can be used in various applications. The antibody is produced using a hybridoma cell line and has been extensively tested for its specificity and efficacy.</p>

<p>Recombinant human ASL protein (His tag)</p>

<p>Purified native Transferrin protein (Bovine)</p>

<p>Rabbit polyclonal PKG2 antibody</p>

<p>Rabbit polyclonal CBCP2 antibody</p>

<p>FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI</p>

<p>Rabbit Polyclonal Tau antibody (Thr181)</p>

<p>HDAC10 antibody was raised in rabbit using recombinant human HDAC 10 protein as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFS8 antibody, catalog no. 70R-10376</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALPPL2 antibody, catalog no. 70R-1575</p>

<p>C1ORF55 antibody was raised using the C terminal Of C1Orf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID</p>

<p>The PDI antibody is a polyclonal antibody that is used in the field of life sciences. It specifically targets the protein disulfide isomerase (PDI), which plays a crucial role in protein folding and assembly. The PDI antibody can be used in various immunoassays to detect and quantify PDI levels in samples. It is commonly used in conjunction with other antibodies, such as monoclonal antibodies against specific proteins like trastuzumab or epidermal growth factor receptor (EGFR).</p>

<p>Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.</p>

<p>The Human IgM protein is a monoclonal antibody that targets various proteins involved in cell growth and development. It specifically binds to trastuzumab, an anti-HER2 antibody, and inhibits the activity of epidermal growth factor (EGF), fibronectin, hepatocyte growth factor (HGF), β-catenin, collagen, VEGF-C, and other growth factors. This purified immunoglobulin has been extensively studied in Life Sciences research and has shown promising results in inhibiting multidrug resistance and promoting endothelial cell growth. Its potent anti-growth factor properties make it a valuable tool for studying cell signaling pathways and developing targeted therapies for various diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MOSPD2 antibody, catalog no. 70R-6990</p>

<p>Rabbit polyclonal PSME3 antibody (HRP)</p>

<p>Purified native Dengue Type 1 protein</p>

<p>LTB4R antibody was raised in rabbit using the C terminal of LTB4R as the immunogen</p>

<p>Nucleolar Helicase antibody was raised in mouse using human recombinant polypeptide as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FERMT1 antibody, catalog no. 70R-2667</p>