Bioquímicos e reagentes

<p>Mouse monoclonal NK1.1 antibody (FITC)</p>

<p>Please enquire for more information about 4-Methoxy(toluene-d7) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TAF15 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYS</p>

<p>PAPK antibody was raised in rabbit using residues 399-418 (SPWSELEFQFPDDKDPVWEF) of the mouse PAPK protein as the immunogen.</p>

<p>TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL</p>

<p>Mouse monoclonal NUPR1 antibody</p>

<p>Mouse monoclonal H6PD antibody</p>

<p>Purified recombinant GAGE2D protein (His tag)</p>

<p>Purified Polyclonal CstF 64 antibody</p>

<p>ZNF451 antibody was raised in rabbit using the C terminal of ZNF451 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. The effectiveness of this drug has been proven through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Furthermore, it undergoes metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The UBE1 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of polyclonal antibodies and is specifically designed for inhibiting the activity of ubiquitin, a protein involved in various cellular processes. This antibody is highly effective in blocking the function of ubiquitin, making it an essential tool for researchers studying the role of ubiquitin in protein degradation, DNA repair, and other important cellular pathways. With its high specificity and potency, the UBE1 antibody is a valuable asset for any laboratory working in the field of molecular biology.</p>

<p>Rabbit polyclonal GBP3 antibody</p>

<p>MPRIP antibody was raised in Rabbit using Human MPRIP as the immunogen</p>

<p>MRGPRF antibody was raised in rabbit using the C terminal of MRGPRF as the immunogen</p>

<p>The MMP3 antibody is a highly specialized antibody that targets matrix metalloproteinase 3 (MMP3). This antibody is extensively used in the field of Life Sciences for various applications. It is a glycosylated protein that belongs to the family of matrix metalloproteinases, which play a crucial role in tissue remodeling and degradation. The MMP3 antibody specifically binds to MMP3 and inhibits its activity, making it an essential tool for studying the function of this enzyme.</p>

<p>The P130 antibody is a monoclonal antibody that is produced by a hybridoma cell line. It belongs to the class of chimeric proteins and is widely used in Life Sciences research. This antibody specifically targets and binds to the amino-terminal region of natriuretic peptides, which are important biomarkers for heart-related diseases. The P130 antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. It has high specificity and sensitivity, making it an ideal tool for studying the expression and function of natriuretic peptides in different tissues and cell types. The P130 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs. Trust in the reliability and quality of the P130 antibody for your research needs in the field of Life Sciences.</p>

<p>DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS</p>

<p>Rabbit polyclonal MYL3 antibody</p>

<p>GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GPC3 antibody was raised in Rabbit using Human GPC3 as the immunogen</p>

<p>Rabbit polyclonal GOLM1 antibody (biotin)</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>KLHL13 antibody was raised in Rabbit using Human KLHL13 as the immunogen</p>

<p>Purified recombinant ACAT1 protein</p>

<p>PDE7B antibody was raised using the middle region of PDE7B corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN</p>

<p>The LIMK1 antibody is an inhibitor that has a strong inhibitory effect on kinase activity. It is commonly used in the field of Life Sciences as both a diagnostic agent and a research tool. This monoclonal antibody specifically targets the LIMK1 protein kinase, which plays a crucial role in actin depolymerization. By blocking the activity of LIMK1, this antibody can effectively inhibit cell migration and invasion, making it a potential candidate for anti-cancer therapies. Additionally, the LIMK1 antibody can be used in intraocular applications to study diseases related to abnormal actin dynamics. With its high specificity and potency, this antibody offers great potential for both therapeutic and research purposes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-298P3.3 antibody, catalog no. 70R-9321</p>

<p>Rabbit polyclonal Met antibody (Tyr1356)</p>

<p>Purified Rabbit polyclonal ZNF540 antibody</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HS6ST3 antibody, catalog no. 70R-7460</p>

<p>Purified recombinant CLU protein (His tag)</p>

<p>Mouse monoclonal Sialosyl-Tn antigen antibody</p>

<p>Rabbit polyclonal TBXAS1 antibody</p>

<p>TGOLN2 antibody was raised using the N terminal of TGOLN2 corresponding to a region with amino acids PSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKS</p>

<p>Mouse monoclonal RTN4IP1 antibody</p>

<p>BSA conjugated Cholic acid Hapten</p>

<p>Rabbit polyclonal ABHD12B antibody</p>

<p>Rabbit polyclonal RIOK3 antibody</p>

<p>Rabbit polyclonal RNASEH2A antibody</p>

<p>Goat anti-human lambda chain (Fab'2) was raised in goat using human lambda light chain as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>Rabbit polyclonal IRAK1 antibody (Thr387)</p>

<p>Purified recombinant CD200 protein (His tag)</p>

<p>Sheep polyclonal Methaqualone 4 antibody</p>

<p>Human synthetic cyclin E1 C-terminal KLH-conjugated immunogen; purified polyclonal Cyclin E1 antibody</p>

<p>Rabbit polyclonal RBMS2 antibody</p>

<p>VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE</p>

<p>Mouse monoclonal PRKAR1B antibody</p>