Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.117 produtos)
- Por Alvo Biológico(99.161 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.705 produtos)
- Metabólitos secundários(14.220 produtos)
Foram encontrados 130581 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
MYB antibody
<p>MYB antibody was raised in rabbit using the N terminal of MYB as the immunogen</p>Pureza:Min. 95%Myoglobin antibody
<p>Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.</p>Lp-PLA2 polyclonal antibody
<p>Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2) polyclonal Antibody</p>Pureza:Min. 95%Microginin-d4
CAS:<p>Microginin-d4 is a potent inhibitor that targets the cell cycle and induces apoptosis in human cancer cells. This unique compound has shown promising results in inhibiting tumor growth, particularly in cases of leukemia. Microginin-d4 works by inhibiting kinase activity, which is essential for cancer cell proliferation. This compound is derived from Chinese medicinal herbs and has been isolated from urine samples. Microginin-d4 has also shown to be a promising anticancer agent due to its ability to inhibit protein synthesis and other key pathways involved in cancer cell survival. Its potential as an effective treatment for various types of cancer makes it an exciting area of research in the field of oncology.</p>Fórmula:C37H55N5O9Pureza:Min. 95%Peso molecular:713.9 g/molKRT8 antibody
<p>The KRT8 antibody is a monoclonal antibody used in life sciences research. It specifically targets and binds to keratin 8 (KRT8), a protein found in epithelial cells. This antibody has been widely used in various bioassays and studies to detect the presence of KRT8 in different tissues and cell types. Additionally, it has shown potential therapeutic applications, such as in the development of targeted therapies for certain types of cancer.</p>ATP6AP1 antibody
<p>The ATP6AP1 antibody is a highly specialized antibody that targets the ATP6AP1 protein. This protein is involved in various biological processes, including dopamine synthesis and secretion. The ATP6AP1 antibody has been extensively studied and found to be an effective tool for research purposes.</p>VPS54 antibody
<p>VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR</p>Synaptobrevin 1 protein (His tag)
<p>1-91 amino acids: MGSSHHHHHH SSGLVPRGSH MSAPAQPPAE GTEGTAPGGG PPGPPPNMTS NRRLQQTQAQ VEEVVDIIRV NVDKVLERDQ KLSELDDRAD ALQAGASQFE SSAAKLKRKY W</p>Pureza:Min. 95%RHOD antibody
<p>RHOD antibody was raised using the N terminal of RHOD corresponding to a region with amino acids TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF</p>Pureza:Min. 95%HKR1 antibody
<p>HKR1 antibody was raised in rabbit using the C terminal of HKR1 as the immunogen</p>Pureza:Min. 95%TIGD4 antibody
<p>TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK</p>DHX9 antibody
<p>DHX9 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 9 (Dhx9)</p>Angiopoietin 1 antibody
<p>Angiopoietin 1 antibody was raised in rabbit using a synthetic peptide corresponding to a region near the N-terminus of mouse angiopoietin 1 protein conjugated to KLH as the immunogen.</p>Pureza:Min. 95%EPHB4 antibody
<p>EPHB4 antibody was raised in Mouse using a purified recombinant fragment of EphB4 (aa562-612)expressed in E. coli as the immunogen.</p>Chicken anti Rabbit IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Pureza:Min. 95%VEGFR2 antibody
<p>The VEGFR2 antibody is a polyclonal antibody that specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2). This receptor plays a crucial role in angiogenesis, which is the formation of new blood vessels. The VEGFR2 antibody binds to VEGFR2 and inhibits its interaction with growth factors, thereby preventing the activation of downstream signaling pathways involved in blood vessel formation.</p>DSG2 antibody
<p>The DSG2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to a specific antigen, which plays a crucial role in cell growth and development. This antibody has been extensively tested and proven to be effective in inhibiting the activity of growth factors, thereby preventing the proliferation of certain cells.</p>MAP4K1 antibody
<p>MAP4K1 antibody was raised using the N terminal of MAP4K1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK</p>HIRIP3 antibody
<p>HIRIP3 antibody was raised in mouse using recombinant Human Hira Interacting Protein 3</p>SOCS3 antibody
<p>The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.</p>ANGPTL7 protein
<p>The ANGPTL7 protein is a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential therapeutic applications in the field of life sciences. Teriparatide, a steroid, has shown to interact with ANGPTL7 and modulate its activity. Binding proteins and monoclonal antibodies have been developed to specifically target ANGPTL7 and neutralize its effects.</p>Pureza:Min. 95%CBLN4 antibody
<p>CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK</p>Pureza:Min. 95%CER5-2′R(d9)
CAS:Produto Controlado<p>CER5-2′R(d9) is an ion channel ligand that is a high-affinity antagonist of the nicotinic acetylcholine receptor. It blocks the nicotinic acetylcholine receptor by binding to the extracellular domain of the receptor, preventing it from opening. CER5-2′R(d9) has been shown to be a potent inhibitor of protein interactions with its ability to inhibit antibody binding, peptide binding, and cell biology studies.</p>Fórmula:C34H58D9NO4Pureza:Min. 95%Peso molecular:562.96 g/molBIN3 antibody
<p>The BIN3 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets adipose triglyceride lipase (ATGL), a key enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications, as well as its role in understanding the mechanisms of obesity and related metabolic disorders.</p>SAE1 antibody
<p>SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE</p>ATG10 antibody
<p>ATG10 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP</p>DDX3 antibody
<p>The DDX3 antibody is a monoclonal antibody that specifically targets the DDX3 protein. It has been widely used in life sciences research to study various biological processes, including receptor binding, antigen binding, and protein-protein interactions. The DDX3 antibody can also be used as a diagnostic tool for detecting the presence of DDX3 in samples.</p>GST antibody
<p>The GST antibody is a monoclonal antibody that specifically targets glutathione S-transferase (GST). It is widely used in life sciences research and various assays. This antibody can be used to detect the presence of GST in samples, making it a valuable tool for studying the role of GST in cellular processes. Additionally, the GST antibody has been shown to have cytotoxic effects on cancer cells expressing annexin A2, suggesting its potential as a therapeutic agent. With its high specificity and sensitivity, this antibody is an essential component for researchers studying insulin and glucagon signaling pathways, as well as other areas of interest in the field of life sciences.</p>Connexin 43 antibody
<p>The Connexin 43 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to Connexin 43, a protein involved in cell-to-cell communication. This antibody has been extensively studied and proven to be effective in various applications.</p>POLB antibody
<p>POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML</p>Pureza:Min. 95%PROM2 antibody
<p>The PROM2 antibody is a highly specialized monoclonal antibody that targets the collagen protein. It has been extensively studied in the field of Life Sciences for its role in various biological processes. This antibody specifically recognizes and binds to PROM2, a protein that is involved in the regulation of alpha-fetoprotein, globulin, and albumin levels.</p>HAO1 antibody
<p>The HAO1 antibody is a nuclear autoantibody that belongs to the class of Monoclonal Antibodies. It specifically targets the octanoyltransferase and methyl transferase enzymes, which are involved in high-flux metabolic pathways. This antibody has been extensively studied as a biomarker for various diseases and conditions, including interleukin disorders and carnitine deficiencies. The HAO1 antibody is used in research and diagnostic assays to detect the presence of these enzymes and their inhibitors. Its high specificity and sensitivity make it an essential tool in the field of Life Sciences.</p>CACNA1I antibody
<p>CACNA1I antibody was raised using the middle region of CACNA1I corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS</p>Glucagon antibody
<p>The Glucagon antibody is a monoclonal antibody that has been developed for use in bioassays and immunoassays. It specifically targets the antigen binding domain of lipoprotein lipase, an enzyme involved in lipid metabolism. This monoclonal antibody is highly reactive and has been extensively studied in Life Sciences research.</p>ZNF12 antibody
<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>Pureza:Min. 95%KRR1 antibody
<p>KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET</p>KIAA1191 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4315</p>Pureza:Min. 95%
