Bioquímicos e reagentes

<p>Ethyl rosmarinate is an esterified derivative of rosmarinic acid, which is naturally sourced from the rosemary plant (Rosmarinus officinalis). This compound exhibits potent antioxidant properties, acting primarily by scavenging free radicals and inhibiting lipid peroxidation. These mechanisms allow it to mitigate oxidative stress within biological systems.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and active compounds. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The effectiveness of this drug has been demonstrated through various techniques such as the patch-clamp technique on human erythrocytes. It undergoes several metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>D-Dimer protein is a glycoprotein that is found in human serum and plays a crucial role in the coagulation process. It is commonly used in Life Sciences research and diagnostics. The D-Dimer protein is produced using an expression plasmid and can be detected using specific antibodies or monoclonal antibodies. This protein can be used for various applications, including the development of diagnostic assays, studying chemokine interactions, and as a control in protein-protein interaction studies. The D-Dimer protein can be immobilized on a carbon electrode to create biosensors for rapid and sensitive detection. It can also be used as a reference standard for the quantification of alpha-fetoprotein or fibrinogen levels in biological samples. With its versatility and importance in coagulation studies, the D-Dimer protein is an essential tool for researchers and scientists in the field of Life Sciences.</p>

<p>The SERP1 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets and binds to the SERP1 protein, which plays a crucial role in proteolysis and phosphatase activity. This antibody can be used for various applications, including research on adeno-associated virus (AAV) biology and gene therapy.</p>

<p>HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN</p>

<p>AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG</p>

<p>Rabbit polyclonal OR9Q2 antibody</p>

<p>Purified Polyclonal DEFA1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.</p>

<p>IP10 antibody was raised in rabbit using highly pure recombinant murine IP-10 as the immunogen.</p>

<p>Recombinant Human ELAVL2 protein (His tag)</p>

<p>Purified Rabbit polyclonal APEH antibody</p>

<p>Rat monoclonal B7DC antibody (FITC)</p>

<p>Mouse monoclonal MATR3 antibody</p>

<p>Rabbit polyclonal Ferritin antibody (Prediluted for IHC)</p>

<p>SIX1 antibody was raised in rabbit using the N terminal of Six1 as the immunogen</p>

<p>Rabbit polyclonal COX7S antibody</p>

<p>1-127 amino acids: MGSSHHHHHH SSGLVPRGSH MKDPSRSSTS PSIINEDVII NGHSHEDDNP FAEYMWMENE EEFNRQIEEE LWEEEFIERC FQEMLEEEEE HEWFIPARDL PQTMDQIQDQ FNDLVISDGS SLEDLVVKSN LNPNAKEFVP GVKYGNI</p>

<p>Purified recombinant rpsS protein (His tag)</p>

<p>Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG</p>

<p>The GKN1 antibody is a monoclonal antibody that plays a crucial role in Life Sciences. It functions as a growth factor and has been found to interact with collagen, olaparib, ferritin, and various proteins. Through molecular docking studies, it has been determined that the GKN1 antibody binds to specific targets such as TGF-beta, interleukin-6, ADP-ribose, chemokine, and glycopeptide. This antibody is highly effective in targeting these molecules and can be used for research purposes in the field of Life Sciences. With its specificity and potency, the GKN1 antibody is an essential tool for scientists working in this area of study.</p>

<p>GRIN2C antibody was raised using the N terminal of GRIN2C corresponding to a region with amino acids VNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVP</p>

<p>HSF1 antibody was raised in rabbit using the C terminal of HSF1 as the immunogen</p>

<p>The Dystrophin antibody is a powerful tool in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes dystrophin, a key protein involved in muscle function. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>KPNA5 antibody was raised in Rabbit using Human KPNA5 as the immunogen</p>

<p>Troponin T Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK</p>

<p>Purified recombinant POLR3K protein (His tag)</p>

<p>GTF2H2 antibody was raised in Rabbit using Human GTF2H2 as the immunogen</p>

<p>Rabbit Polyclonal GJA3 antibody</p>

<p>Rabbit polyclonal A4GNT antibody</p>

<p>Rabbit polyclonal NKX6.3 antibody</p>

<p>Sheep polyclonal 4 Nitrophenyl SEM antibody</p>

<p>ZNF651 antibody was raised in rabbit using the N terminal of ZNF651 as the immunogen</p>

<p>Rabbit polyclonal RPL14 antibody</p>

<p>Purified Polyclonal JNK1/2/3 antibody</p>

<p>PAICS antibody was raised using the N terminal of PAICS corresponding to a region with amino acids ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE</p>

<p>GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The ILF2 antibody is a monoclonal antibody that targets ILF2, also known as interferon regulatory factor 4-binding protein (IRF4BP). ILF2 is involved in various cellular processes, including gene transcription, RNA processing, and protein translation. This antibody specifically recognizes ILF2 and can be used for research purposes in the field of Life Sciences.</p>

<p>RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK</p>

<p>RPH3A antibody was raised in rabbit using the N terminal of RPH3A as the immunogen</p>

<p>The SP1 antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic antibody that targets pluripotent cells and inhibits their growth. This antibody acts as a growth factor, promoting the proliferation and differentiation of various cell types. It has been extensively studied for its role in regulating gene expression and cellular processes.</p>

<p>Rabbit polyclonal Collagen XI alpha 2 antibody</p>

<p>SLC39A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL</p>

<p>Rabbit polyclonal PLA2G4D antibody</p>

<p>Purified recombinant CD79B protein</p>

<p>entB Monoclonal Antibody Biotin</p>

<p>CA2 antibody was raised in rabbit using the N terminal of CA2 as the immunogen</p>

<p>CD25 antibody is a drug that targets the IL-2 receptor, which is involved in immune system activation. It is an anti-CD25 antibody that has been developed as a potential treatment for various diseases, including cancer. CD25 antibody works by blocking the IL-2 receptor and preventing the binding of IL-2, a growth factor that stimulates the proliferation and activation of immune cells. This inhibition of IL-2 signaling can help regulate immune responses and potentially suppress autoimmune reactions. CD25 antibody is a monoclonal antibody, meaning it is produced from a single clone of cells and specifically targets the CD25 antigen on immune cells. It has shown promising results in preclinical studies and is being investigated as a potential therapeutic option in Life Sciences research. The use of CD25 antibody in combination with other drugs, such as histone deacetylase inhibitors or C-C chemokine receptor antagonists, may enhance its efficacy and provide additional benefits.</p>

<p>The Caspase 7 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. This monoclonal antibody is specifically designed to target and detect caspase 7, an important enzyme involved in programmed cell death (apoptosis). It is widely used in research laboratories and medical facilities for various applications, including studying apoptosis pathways, investigating neuroprotective mechanisms, and developing therapeutic strategies.</p>

<p>Rabbit polyclonal TTC39A antibody</p>