Bioquímicos e reagentes

<p>Affinity purified Rabbit polyclonal Ataxin 3 antibody</p>

<p>The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.</p>

<p>The Chk1 antibody is a powerful tool in the field of Life Sciences. It is an interferon-gamma (IFN-γ) antibody that exhibits cytotoxic effects on targeted cells. This polyclonal antibody specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. The Chk1 antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA assays.</p>

<p>ARF1 antibody was raised in Rabbit using Human ARF1 as the immunogen</p>

<p>Mouse monoclonal KHK antibody</p>

<p>CNR1 antibody was raised in Rabbit using Human CNR1 as the immunogen</p>

<p>Rabbit polyclonal WDR77 antibody</p>

<p>APRT antibody was raised in Rabbit using Human APRT as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD9 antibody, catalog no. 70R-10260</p>

<p>Mouse monoclonal FAHD2A antibody</p>

<p>Antithrombin III antibody (HRP) was raised in sheep using human antithrombin purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNN3 antibody, catalog no. 70R-1524</p>

<p>The SOS1 antibody is a highly specialized antibody that targets the SOS1 protein, an oncogene homolog involved in cell signaling pathways. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.</p>

<p>SLC19A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP</p>

<p>GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf64 antibody, catalog no. 70R-6964</p>

<p>Purified Polyclonal DMPK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COPG antibody, catalog no. 70R-3810</p>

<p>The Glycogen Synthase antibody is a powerful tool in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets glycogen synthase, an enzyme involved in glycogen synthesis. This antibody has been extensively studied and validated for its high specificity and sensitivity.</p>

<p>Affinity purified Rabbit polyclonal Leucine zipper protein 1 antibody</p>

<p>USP8 antibody was raised in rabbit using the C terminal of USP8 as the immunogen</p>

<p>Mouse monoclonal Exendin 4 antibody (Biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOCS7 antibody, catalog no. 70R-5835</p>

<p>ELMOD1 antibody was raised in rabbit using the middle region of ELMOD1 as the immunogen</p>

<p>MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL</p>

<p>The DGKA antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the nuclear growth factor tyrosine kinase receptor and calmodulin. This antibody has been extensively studied for its role in various cellular processes, including the regulation of actin filaments and the production of interleukin-6. Additionally, it has shown potential therapeutic applications in the field of steroid and chemokine research. The DGKA antibody is a valuable tool for scientists studying these pathways and exploring new avenues for drug development.</p>

<p>Purified Polyclonal POLR2H antibody</p>

<p>The AKAP12 antibody is a highly specialized monoclonal antibody that targets the AKAP12 protein. This protein plays a crucial role in regulating various cellular processes, including cell growth and proliferation. The AKAP12 antibody has been extensively studied for its ability to inhibit the activity of the AKAP12 protein, making it an invaluable tool for researchers in the field of life sciences.</p>

<p>The Chlorpyrifos antibody is a monoclonal antibody produced by a hybridoma cell line. It is designed to specifically bind to chlorpyrifos, an organophosphate insecticide commonly used in agriculture. This antibody can be used for various applications in the field of Life Sciences, including immunoassays and research studies.</p>

<p>XRCC3 antibody was raised in rabbit using the middle region of XRCC3 as the immunogen</p>

<p>WDR33 antibody was raised using the middle region of WDR33 corresponding to a region with amino acids TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL</p>

<p>Purified recombinant Human UFM1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFIT2 antibody, catalog no. 70R-5799</p>

<p>HEF1/NEDD-9 Monoclonal Antibody</p>

<p>MLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK</p>

<p>MMP9 antibody was raised in mouse using a synthetic peptide corresponding to amino acid 626-644 of human MMP9 as the immunogen.</p>

<p>Purified recombinant CD3G protein (His tag)</p>

<p>The Ferritin antibody is a powerful tool used in the field of Life Sciences. This monoclonal antibody specifically targets ferritin, a protein responsible for storing iron in cells. By binding to ferritin, this antibody can be activated to perform various functions.</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPT1B antibody, catalog no. 70R-6487</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UNG antibody, catalog no. 70R-10266</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC38 antibody, catalog no. 70R-3282</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR1D1 antibody, catalog no. 70R-1926</p>

<p>Neurocan Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DFFB antibody, catalog no. 70R-5928</p>

<p>The PCIP antibody is a highly specialized monoclonal antibody that targets the fas-mediated apoptosis pathway. It has been extensively studied in adipose tissue and has shown cytotoxic effects on cells expressing high levels of interleukin-6 (IL-6) and growth factor receptors. This monoclonal antibody specifically binds to β-catenin, a key protein involved in cell signaling and regulation of gene expression. It has also been shown to interact with other monoclonal antibodies targeting collagen, erythropoietin, fibrinogen, and phosphatase. The PCIP antibody disrupts the organization of actin filaments within cells, leading to apoptosis and inhibition of cell growth.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HERC5 antibody, catalog no. 70R-5525</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, which inhibits bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Hamster RBC antibody was raised in rabbit using hamster erythrocytes as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH1A2 antibody, catalog no. 70R-9886</p>