Bioquímicos e reagentes

<p>IgG2c antibody was raised in Mouse using Rat IgG2c as the immunogen.</p>

<p>C20ORF116 antibody was raised using the N terminal Of C20Orf116 corresponding to a region with amino acids PLHNEELAGAGRVAQPGPLEPEEPRAGGRPRRRRDLGSRLQAQRRAQRVA</p>

<p>Recombinant Human SH3GL3 protein (His tag)</p>

<p>The ADRA2A antibody is a powerful tool used in Life Sciences research. It specifically targets the ADRA2A protein, which plays a crucial role in various physiological processes such as influenza hemagglutinin binding and glucose-6-phosphate metabolism. This antibody has been extensively studied and validated for its specificity and sensitivity.</p>

<p>Recombinant Human IL12 protein</p>

<p>The CD38 antibody is a highly specialized monoclonal antibody that binds to CD38, a protein found on the surface of certain cells. This antibody has cytotoxic properties and can be used in various applications, including research and diagnostics. It specifically targets CD38-expressing cells and can be used to study their function or as a therapeutic agent.</p>

<p>Rabbit polyclonal CAGE1 antibody</p>

<p>ApoE3 antibody was raised in rabbit using highly pure recombinant human ApoE3 as the immunogen.</p>

<p>Purified Polyclonal ARMCX2 antibody</p>

<p>PRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV</p>

<p>Antistreptolysin O protein is a versatile compound that has been studied extensively in the field of Life Sciences. It has shown promising results in various applications, thanks to its unique characteristics. This protein has been found to play a crucial role in ischemia reperfusion and is known to regulate acetylation levels through its interaction with histone deacetylase inhibitors.</p>

<p>TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL</p>

<p>Mouse monoclonal RFXANK antibody</p>

<p>Ethyl rosmarinate is an esterified derivative of rosmarinic acid, which is naturally sourced from the rosemary plant (Rosmarinus officinalis). This compound exhibits potent antioxidant properties, acting primarily by scavenging free radicals and inhibiting lipid peroxidation. These mechanisms allow it to mitigate oxidative stress within biological systems.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and active compounds. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The effectiveness of this drug has been demonstrated through various techniques such as the patch-clamp technique on human erythrocytes. It undergoes several metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>D-Dimer protein is a glycoprotein that is found in human serum and plays a crucial role in the coagulation process. It is commonly used in Life Sciences research and diagnostics. The D-Dimer protein is produced using an expression plasmid and can be detected using specific antibodies or monoclonal antibodies. This protein can be used for various applications, including the development of diagnostic assays, studying chemokine interactions, and as a control in protein-protein interaction studies. The D-Dimer protein can be immobilized on a carbon electrode to create biosensors for rapid and sensitive detection. It can also be used as a reference standard for the quantification of alpha-fetoprotein or fibrinogen levels in biological samples. With its versatility and importance in coagulation studies, the D-Dimer protein is an essential tool for researchers and scientists in the field of Life Sciences.</p>

<p>The SERP1 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets and binds to the SERP1 protein, which plays a crucial role in proteolysis and phosphatase activity. This antibody can be used for various applications, including research on adeno-associated virus (AAV) biology and gene therapy.</p>

<p>HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN</p>

<p>AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG</p>

<p>Rabbit polyclonal OR9Q2 antibody</p>

<p>Purified Polyclonal DEFA1 antibody</p>

<p>BTG1 antibody was raised in Rabbit using Human BTG1 as the immunogen</p>

<p>The PRL antibody is a monoclonal antibody that specifically binds to prolactin (PRL), a hormone involved in various physiological processes. This antibody is widely used in life sciences research for its ability to detect and quantify PRL levels in biological samples. It can be used in techniques such as enzyme-linked immunosorbent assay (ELISA) or immunohistochemistry to study the role of PRL in different biological systems. The PRL antibody is also commonly used for protein purification and immobilization, as it can easily bind to chromatographic resins or solid supports. With its high affinity and specificity, this antibody provides researchers with a valuable tool for studying PRL-related processes and developing diagnostic assays.</p>

<p>The PSCA antibody is a highly specialized monoclonal antibody that targets the prostate stem cell antigen (PSCA). It is designed to neutralize the growth factor associated with PSCA, inhibiting its activity and preventing the progression of certain types of cancer. This antibody has shown promising results in preclinical studies, demonstrating its ability to activate an immune response against cancer cells expressing high levels of PSCA. Additionally, it has been shown to have antiviral properties, specifically against influenza hemagglutinin. The PSCA antibody is a valuable tool in the field of oncology and viral research, offering potential therapeutic benefits for patients.</p>

<p>Rabbit polyclonal TJAP1 antibody</p>

<p>Propoxyphene Conjugate for use in immunoassays</p>

<p>Thiamphenicol Conjugate for use in immunoassays</p>

<p>Substrate binding domain, C-term; 385-638 amino acids: MDVKDVLLLD VTPLSLGIET MGGVMTTLIA KNTTIPTKHS QVFSTAEDNQ SAVTIHVLQG ERKRAADNKS LGQFNLDGIN PAPRGMPQIE VTFDIDADGI LHVSAKDKNS GKEQKITIKA SSGLNEDEIQ KMVRDAEANA EADRKFEELV QTRNQGDHLL HSTRKQVEEA GDKLPADDKT AIESALTALE TALKGEDKAA IEAKMQELAQ VSQKLMEIAQ QQHAQQQTAG ADASANNAKD DDVVDAEFEE VKDKK</p>

<p>HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK</p>

<p>Dtx3 antibody was raised in rabbit using the C terminal of Dtx3 as the immunogen</p>

<p>Purified recombinant IGFBP6 protein (His tag)</p>

<p>The TMED2 antibody is an essential tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to TMED2, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in neutralizing the activity of TMED2.</p>

<p>The FXN antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in endothelial growth and is widely used in various research applications. This antibody specifically targets calmodulin, a protein involved in signal transduction and cell proliferation.</p>

<p>I-Msh is a peptide that was originally discovered in the central nervous system of mammals. It is a ligand for ion channels and its binding site has been mapped to the extracellular domain of the channel protein. I-Msh inhibits the activity of potassium channels, which are involved in the propagation of nerve impulses. I-Msh also binds to receptors on immune cells and regulates their activity. I-Msh has been used as a research tool to study ion channels and receptor interactions, as well as to characterize peptides and antibodies.</p>

<p>Purified recombinant HERC5 protein (His tag)</p>

<p>HIST2H2AA3 antibody was raised using the middle region of HIST2H2AA3 corresponding to a region with amino acids PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK</p>

<p>Rabbit polyclonal WDR24 antibody</p>

<p>RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV</p>

<p>Purified Rabbit polyclonal FUBP3 antibody</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>MAN1A2 antibody was raised using the middle region of MAN1A2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE</p>

<p>The EGFR antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell signaling and has been implicated in various diseases, including cancer.</p>

<p>FAM83B antibody was raised using the C terminal of FAM83B corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF</p>

<p>Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV</p>

<p>Mouse monoclonal CD106 antibody (biotin)</p>

<p>The PARK7 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of phosphatase enzymes. This antibody has been extensively studied for its potential therapeutic applications in various fields, including insulin signaling, collagen synthesis, chemokine regulation, nuclear processes, and growth factor signaling.</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>GTSE1 antibody was raised using the middle region of GTSE1 corresponding to a region with amino acids IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF</p>

<p>The SMS antibody is a powerful tool in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets and binds to HER2 receptors, which are overexpressed in certain types of cancer cells. This antibody can be used for various applications, such as immunofluorescence (IF) staining or Western blotting, to detect the presence of HER2 proteins in samples.</p>

<p>Purified recombinant ARMC10 protein (His tag)</p>