Bioquímicos e reagentes

<p>Rabbit polyclonal Cytokeratin 8 antibody (Ser431)</p>

<p>BTN2A1 antibody was raised in Rabbit using Human BTN2A1 as the immunogen</p>

<p>The EGFL6 antibody is a highly specialized antibody that targets the steroid hormone β-catenin. It is available in both polyclonal and monoclonal forms, making it suitable for various research applications. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy.</p>

<p>The IL13RA2 antibody is a powerful tool used in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets the interleukin-13 receptor alpha 2 (IL13RA2). This antibody has shown high affinity and specificity for IL13RA2, making it an ideal choice for various research applications.</p>

<p>Rabbit polyclonal IGF1R antibody (Tyr1165/Tyr1166)</p>

<p>TrkC antibody was raised in goat using the entire extracellular domain of rat TrkC receptor as the immunogen.</p>

<p>The Ataxin 2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to annexin, a protein involved in various cellular processes. This buffered monoclonal antibody has been extensively tested and validated for its efficacy and specificity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPDL antibody, catalog no. 70R-1322</p>

<p>Biotin conjugated Rabbit polyclonal Ovalbumin antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR87 antibody, catalog no. 70R-3913</p>

<p>Purified Rabbit polyclonal OR51A4 antibody</p>

<p>The SREBP1 antibody is a powerful tool used in life sciences research to study various aspects of cellular processes. It specifically targets the Sterol Regulatory Element-Binding Protein 1 (SREBP1), which plays a crucial role in lipid metabolism and the regulation of fatty acid synthesis.</p>

<p>WDR35 antibody was raised using the N terminal of WDR35 corresponding to a region with amino acids SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS</p>

<p>1-171 amino acids: MGSSHHHHHH SSGLVPRGSH MAKFVIRPAT AADCSDILRL IKELAKYEYM EEQVILTEKD LLEDGFGEHP FYHCLVAEVP KEHWTPEGHS IVGFAMYYFT YDPWIGKLLY LEDFFVMSDY RGFGIGSEIL KNLSQVAMRC RCSSMHFLVA EWNEPSINFY KRRGASDLSS EEGWRLFKID KEYLLKMATE E</p>

<p>Rat monoclonal CD90.2 antibody (PE)</p>

<p>Rabbit polyclonal IL8 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHOD antibody, catalog no. 70R-5765</p>

<p>Rabbit polyclonal Glycogen Synthase antibody (Ser645)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH6A1 antibody, catalog no. 70R-6489</p>

<p>GTDC1 antibody was raised in Rabbit using Human GTDC1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZSCAN1 antibody, catalog no. 70R-8462</p>

<p>ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK</p>

<p>Rabbit polyclonal RPL27 antibody (biotin)</p>

<p>Lzts1 antibody was raised in rabbit using the C terminal of Lzts1 as the immunogen</p>

<p>Purified Polyclonal TNF beta antibody</p>

<p>CHSY2 antibody was raised using the N terminal Of Chsy-2 corresponding to a region with amino acids PPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGGAAGQRRDGRPGSSHNG</p>

<p>Purified Polyclonal EEF1G antibody</p>

<p>Purified recombinant Human BLNK protein</p>

<p>Mouse monoclonal ALOX15 antibody</p>

<p>AKT1 protein is a reactive protein that plays a crucial role in various cellular processes. It is commonly used in Life Sciences research for its involvement in cell growth, proliferation, and survival. AKT1 protein can be utilized as a biomarker to study different diseases and conditions. It can be detected using techniques such as polymerase chain reaction (PCR) or monoclonal antibody-based assays. Additionally, AKT1 protein has been found to interact with other proteins, such as epidermal growth factor receptor (EGFR), through molecular docking studies. This interaction suggests its potential involvement in signaling pathways related to cell growth and development. Furthermore, AKT1 protein has been shown to exhibit hemolytic activity when exposed to certain conditions, making it an interesting target for further investigation in the field of Conjugated Proteins and Antigens research.</p>

<p>Purified Polyclonal NMDAR2C antibody</p>

<p>Rabbit polyclonal STAT2 antibody (Tyr631)</p>

<p>Cytokeratin 5 antibody is a high-quality monoclonal antibody that specifically targets the apical membrane protein phosphatase. It plays a crucial role in regulating cell growth and differentiation by binding to tyrosine residues on epidermal growth factor receptors. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>AGBL2 antibody was raised in Rabbit using Human AGBL2 as the immunogen</p>

<p>The PCNP antibody is a highly specialized and versatile product used in the field of Life Sciences. This antibody is derived from adeno-associated virus and has been pegylated for enhanced stability and efficacy. It specifically targets actin filaments, which play a crucial role in various cellular processes.</p>

<p>PF4 antibody was raised in rabbit using highly pure recombinant hPF-4 as the immunogen.</p>

<p>Rabbit polyclonal MNK1 antibody</p>

<p>The B7H4 antibody is a monoclonal antibody that targets the B7H4 protein, which is expressed on the surface of tumor cells. This antibody has been shown to have potent anti-tumor activity and can effectively inhibit tumor growth. It works by blocking the interaction between B7H4 and its receptor, preventing the suppression of immune responses against tumor cells. In addition, the B7H4 antibody has been found to enhance the production of interferon-gamma (IFN-gamma) and interleukin-6 (IL-6), which are important cytokines involved in immune regulation. This antibody is highly specific for human B7H4 and does not cross-react with other proteins. It has been extensively tested in various preclinical models and has shown promising results in terms of efficacy and safety. The B7H4 antibody is a valuable tool for researchers in the field of Life Sciences who are studying tumor immunology and developing novel cancer therapies.</p>

<p>Purified recombinant Human TANK protein (His tag)</p>

<p>Rabbit polyclonal TMEM70 antibody</p>

<p>The TGF beta 2 antibody is a monoclonal antibody that specifically targets and neutralizes the activity of TGF-beta 2, a growth factor involved in various biological processes. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the effects of TGF-beta 2 on cell proliferation, migration, and differentiation. It has also been found to have cytotoxic effects on certain cancer cells and can be used as a tool for studying the role of TGF-beta 2 in different disease models. Additionally, this antibody has been used in diagnostic applications to detect the presence of TGF-beta 2 in biological samples. With its high specificity and neutralizing properties, the TGF beta 2 antibody is a valuable tool for researchers studying growth factors, chemokines, and other signaling molecules involved in cellular processes.</p>

<p>The PFHRP2 protein is a pluripotent cell protein that plays a crucial role in various biological processes. It is widely used in the field of Life Sciences for its diverse applications. This protein has been found to be associated with microvessel density, indicating its involvement in angiogenesis and blood vessel formation. Additionally, PFHRP2 has been shown to interact with glutamate, a major neurotransmitter, suggesting its potential role in neuronal development and function.</p>

<p>Rabbit polyclonal SMAD1 antibody (Ser465)</p>

<p>Zearalanone 7 Conjugate for use in immunoassays</p>

<p>MTMR4 antibody was raised in Rabbit using Human MTMR4 as the immunogen</p>

<p>AKAP8L antibody was raised in Rabbit using Human AKAP8L as the immunogen</p>

<p>Mouse monoclonal ACAT2 antibody</p>

<p>TMEFF1 antibody was raised using the middle region of TMEFF1 corresponding to a region with amino acids YSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNID</p>

<p>Purified recombinant Human SNX1 protein</p>

<p>Purified Polyclonal RPL17 antibody</p>