Bioquímicos e reagentes

<p>ODC antibody is a monoclonal antibody that specifically targets and neutralizes the activity of ornithine decarboxylase (ODC). ODC is an enzyme that plays a key role in the synthesis of polyamines, which are essential for cell growth and proliferation. By inhibiting ODC, this antibody effectively blocks the production of polyamines and disrupts cell growth processes.</p>

<p>FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL</p>

<p>Purified Polyclonal SLP76 antibody</p>

<p>The HER2 antibody is a highly effective monoclonal antibody that targets the HER2 protein, which is overexpressed in certain types of cancer cells. This antibody has a high affinity for the HER2 receptor and can effectively block its signaling pathway, inhibiting tumor growth and proliferation.</p>

<p>Region of MIG protein corresponding to amino acids TLVIRNARCS CISTSRGTIH YKSLKDLKQF APSPNCNKTE IIATLKNGDQ TCLDPDSANV KKLMKEWEKK INQKKKQKRG KKHQKNMKNR KPKTPQSRRR SRKTT.</p>

<p>EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT</p>

<p>Rabbit polyclonal Vav antibody (Tyr174)</p>

<p>ABCD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT</p>

<p>MKNK1 antibody was raised in Rabbit using Human MKNK1 as the immunogen</p>

<p>TNF-± Antagonist III is a drug that is used to inhibit the production of TNF-α. It has been shown to regulate transcriptional activity in cells and to inhibit the growth of cancer cells. TNF-± Antagonist III has been observed to decrease the M2 phenotype, which may be due to its ability to activate ATP levels in macrophages. This drug also inhibits kidney fibrosis by reducing pro-inflammatory factors, such as tumor necrosis factor-α (TNF-α) and fatty acids. The drug also has effects on abdominal surgery, as it reduces inflammation following this type of procedure. TNF-± Antagonist III is used in fat tissue and adipose tissue, where it reduces the number of pro-inflammatory factors produced by macrophages.</p>

<p>Donkey anti-mouse IgG (H + L) (FITC) was raised in donkey using mouse IgG (H&amp;L) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD16 antibody, catalog no. 70R-4380</p>

<p>Purified Rabbit polyclonal HECW2 antibody</p>

<p>Hsp70, His tagged human, is a recombinant protein, which is derived from human cells and engineered with a hexahistidine (His) tag. It is part of the Heat Shock Protein 70 family, known for its crucial role in cellular stress response. The His tag facilitates purification and detection via affinity chromatography, making it a convenient tool for research applications.</p>

<p>Also known as Protein-L-isoaspartate D-aspartate O-methyltransferase, PIMT, L-isoaspartyl protein carboxyl methyltransferase, Protein L-isoaspartyl/D-aspartyl methyltransferase, Protein-beta-aspartate methyltransferase.</p>

<p>FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG</p>

<p>X-34 is a p-glycoprotein (p-gp) inhibitor that is used to prevent the accumulation of toxic drugs in certain tissues, such as the brain. X-34 binds to the drug transporter protein, inhibiting its function. This leads to an increase in the concentration of the drug at target sites and reduces toxicity. X-34 has been shown to be effective against resistant mutants of p-gp substrates, such as paclitaxel and vincristine. The conformational properties of X-34 have been determined by x-ray diffraction data and molecular modelling techniques. The hydroxyl group on the phenyl ring has been shown to interact with other compounds, which may lead to adverse reactions when combined with other drugs. X-34 inhibits transcription and replication by binding to DNA polymerase II or RNA polymerase II. This binding prevents transcription and replication by preventing DNA synthesis or RNA synthesis, respectively.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MANEA antibody, catalog no. 70R-7439</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD54B antibody, catalog no. 70R-5652</p>

<p>The FGF Receptor 1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the FGF Receptor 1 protein. This antibody has been extensively studied and proven to have potent neutralizing activity against FGF Receptor 1, making it an ideal tool for research in the field of Life Sciences.</p>

<p>Purified Polyclonal E2F6 antibody</p>

<p>Rabbit polyclonal GADD45GIP1 antibody</p>

<p>Apadenoson-d5 is a synthetic ligand for the beta 2 adrenergic receptor, a protein that regulates the rate of cellular metabolism and the release of hormones. It has been shown to bind to both rat and human beta 2 adrenergic receptors with high affinity. Apadenoson-d5 has also been shown to inhibit the function of adenylate cyclase, an enzyme involved in the production of cAMP, which is important for many cell functions including signaling. Apadenoson-d5 may be used as a research tool or pharmacological agent.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GATAD2A antibody, catalog no. 20R-1164</p>

<p>Rabbit polyclonal LMTK3 antibody</p>

<p>The PYY protein is a recombinant protein that falls under the category of Recombinant Proteins &amp; Antigens. It is commonly used in the field of Life Sciences for various applications. PYY protein is known to have autoantibodies and can be used to detect specific oligonucleotides. It can also be utilized as a monoclonal antibody in research and diagnostic settings.</p>

<p>CD66b was raised in mouse using human CD66b as the immunogen.</p>

<p>LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI</p>

<p>The 14-3-3 theta antibody is an essential tool in Life Sciences research. It is a high-quality antibody that specifically targets the 14-3-3 theta protein. This protein plays a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis.</p>

<p>Rat monoclonal IgM Isotype Control Fc fusion protein (PE)</p>

<p>Rabbit polyclonal HMG17 antibody</p>

<p>CDC5L antibody was raised in mouse using recombinant Human Cdc5 Cell Division Cycle 5-Like (S. Pombe) (Cdc5L)</p>

<p>Rabbit polyclonal FUCA2 antibody (FITC)</p>

<p>The PEX5 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of PEX5, a protein involved in various cellular processes. This antibody is activated and reactive, making it highly effective in inhibiting the function of PEX5.</p>

<p>Rabbit polyclonal TOR1A antibody</p>

<p>ARF1 Monoclonal Antibody (FITC)</p>

<p>Goat anti-human kappa chain (Fab'2) was raised in goat using human kappa light chain as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal HLA DMB antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRF3 antibody, catalog no. 20R-1177</p>

<p>OR2H1 antibody was raised in rabbit using the C terminal of OR2H1 as the immunogen</p>

<p>The MIA antibody is a polyclonal antibody that specifically targets annexin A2. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. The MIA antibody has shown high affinity and specificity towards its target, making it a valuable tool in studying the role of annexin A2 in different biological processes.</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids DPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQV</p>

<p>PF-06815345 is a kinetic convertase inhibitor that binds to the active site of the enzyme, inhibiting its activity. This compound has been shown to inhibit human low-density lipoprotein (LDL) cholesterol production in vitro and reduce plasma LDL-cholesterol levels in vivo. The mechanism of action of PF-06815345 is not clear, but it may be due to inhibition of statin catalysis, which leads to a decrease in the level of functional LDL receptors on liver cells. The drug also inhibits the activity of serine proteases such as subtilisin and kexin type enzymes. In addition, PF-06815345 has been shown to be an organocatalyst for low-temperature aldehyde synthesis, with tetrazole as a key intermediate. It is also used for treatment of cardiovascular diseases such as high blood pressure and elevated levels of low density lipoprotein cholesterol (LDL-C).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHGC4 antibody, catalog no. 70R-6141</p>

<p>CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV</p>

<p>Inhibitor of ATP-sensitive potassium channels</p>

<p>ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD</p>

<p>Purified recombinant Human CD247 protein (His tag)</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Poloppin is a chemical compound that inhibits the activity of plk1, an enzyme that plays an important role in cell division. Poloppin binds to the ATP binding site of plk1 and blocks its function by preventing ATP from binding. It has been shown to inhibit mitotic checkpoint and cellular proliferation in cancer cells. This compound also induces apoptotic cell death through biochemical signaling pathways.</p>