Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD54L antibody, catalog no. 70R-5645</p>

<p>Rabbit Polyclonal TrkA antibody (Ser791)</p>

<p>MESP2 antibody was raised in rabbit using the C terminal of MESP2 as the immunogen</p>

<p>Rabbit polyclonal GABRB1 antibody (Ser434)</p>

<p>Purified recombinant Human EIF1AX protein</p>

<p>CD31 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that targets CD31, also known as platelet endothelial cell adhesion molecule-1 (PECAM-1). CD31 is a transmembrane glycoprotein expressed on the surface of endothelial cells, platelets, and leukocytes. It plays a crucial role in cell adhesion, angiogenesis, and vascular integrity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of D930005D10RIK antibody, catalog no. 20R-1172</p>

<p>Purified recombinant SHFM1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIGT antibody, catalog no. 70R-7466</p>

<p>20-172 amino acids: MGSSHHHHHH SSGLVPRGSH MAVESRVTQE EIKKEPEKPI DREKTCPLLL RVFTTNNGRH HRMDEFSRGN VPSSELQIYT WMDATLKELT SLVKEVYPEA RKKGTHFNFA IVFTDVKRPG YRVKEIGSTM SGRKGTDDSM TLQSQKFQIG DYLDIAITPP NRAPPPSGRM RPY</p>

<p>Rat monoclonal OCT3/4 antibody</p>

<p>Rabbit Polyclonal ATPAF2 antibody</p>

<p>Hemoglobin antibody was raised in mouse using human hemoglobin as the immunogen.</p>

<p>The CD44 antibody is a specific monoclonal antibody that targets the cell-extracellular matrix interaction. It is widely used in Life Sciences research for its ability to detect and analyze activated or reactive cells. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting. The CD44 antibody recognizes a surface glycoprotein called CD44, which plays a crucial role in cell adhesion, migration, and signaling. By binding to CD44, this antibody can help researchers study the function of this important biomolecule and its involvement in various cellular processes. Additionally, the CD44 antibody has been shown to have cytotoxic effects on certain types of cancer cells, making it a promising tool for targeted therapy.</p>

<p>PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL</p>

<p>Mouse monoclonal PP4C antibody</p>

<p>Rabbit Polyclonal ASK1 antibody (Ser83)</p>

<p>Purified Polyclonal CDC25B antibody</p>

<p>Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMBR1 antibody, catalog no. 70R-6960</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNN3 antibody, catalog no. 70R-5182</p>

<p>CTRL antibody was raised in Rabbit using Human CTRL as the immunogen</p>

<p>ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS</p>

<p>Fgf1 antibody was raised in rabbit using the N terminal of Fgf1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Mrpl21 antibody, catalog no. 70R-8495</p>

<p>LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY</p>

<p>Rabbit polyclonal UBF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INPP5K antibody, catalog no. 70R-10254</p>

<p>Rabbit polyclonal SFXN1 antibody</p>

<p>Purified Polyclonal Caspase 6 p18 antibody</p>

<p>Rabbit polyclonal AKT1/AKT2/AKT3 antibody</p>

<p>ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM</p>

<p>The VCP antibody is a polyclonal antibody that specifically targets the valosin-containing protein (VCP). This protein plays a crucial role in various cellular processes, including protein degradation and DNA repair. The VCP antibody can be used in research and diagnostic applications to study the function and localization of VCP in different cell types and tissues.</p>

<p>The ENO1 antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is produced using animal serum and has been purified using chromatographic techniques to ensure maximum purity and specificity. This antibody specifically targets the ENO1 protein, which acts as a plasminogen receptor and plays a crucial role in various biological processes.</p>

<p>Purified recombinant PYGB protein</p>

<p>ACE antibody was raised in mouse using ACE from human lung as the immunogen.</p>

<p>Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN</p>

<p>SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI</p>

<p>CD4 antibody (biotin) was raised in rat using cloned murine CTL line V4 as the immunogen.</p>

<p>Recombinant Human CLEC5A protein (His tag)</p>

<p>FER antibody was raised in mouse using recombinant Human Fer (Fps/Fes Related) Tyrosine Kinase (Phosphoprotein Ncp94) (Fer)</p>

<p>LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD</p>

<p>The SRY antibody is a highly specialized antibody used for various research and diagnostic purposes. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.</p>

<p>Goat anti-rat IgG (H + L) (Fab'2) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UNC45A antibody, catalog no. 70R-9380</p>

<p>Purified recombinant MMP2 protein (His tag)</p>

<p>NR2F1 antibody was raised in rabbit using the N terminal of NR2F1 as the immunogen</p>

<p>Rabbit polyclonal MMP17 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTA3 antibody, catalog no. 70R-8740</p>

<p>Rabbit polyclonal OR2AJ1 antibody</p>