Bioquímicos e reagentes

<p>Purified recombinant Human UFC1 protein</p>

<p>ZXDA antibody was raised in rabbit using the middle region of ZXDA as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NRCAM antibody, catalog no. 70R-1741</p>

<p>Purified recombinant Human SAMD13 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC69 antibody, catalog no. 70R-3544</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF3 antibody, catalog no. 70R-4686</p>

<p>The SSX1 antibody is a monoclonal antibody that specifically targets the activated form of the elastase protein. It acts as a cation channel blocker, inhibiting the influx of potassium and natriuretic ions. This antibody has been extensively studied in various nuclear assays and has shown high specificity for its target. It can be used in research laboratories to detect and quantify the presence of SSX1 in human serum samples. Additionally, this antibody has potential applications in the field of Life Sciences, particularly in studies related to fibrinogen and lipoprotein lipase. With its exceptional binding affinity and selectivity, the SSX1 antibody is a valuable tool for researchers investigating cellular processes and molecular interactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RIBC1 antibody, catalog no. 70R-4023</p>

<p>This antibody reacts with heavy chains on human IgE (epsilon chain).</p>

<p>Rabbit polyclonal TXNDC12 antibody</p>

<p>Rabbit polyclonal OR2AG1 antibody</p>

<p>PTER antibody was raised in rabbit using the N terminal of PTER as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCL antibody, catalog no. 70R-1328</p>

<p>CCDC72 antibody was raised in Rabbit using Human CCDC72 as the immunogen</p>

<p>CLCN1 antibody was raised in Rabbit using Human CLCN1 as the immunogen</p>

<p>Cyclin E2 antibody was raised in rabbit using residues 2-15 [SRRSSRLQAKQQPQC] of the Cyclin E2 protein as the immunogen.</p>

<p>Rabbit polyclonal TERF2 antibody</p>

<p>Rabbit polyclonal CXCL10 antibody (biotin)</p>

<p>SREBF1 antibody was raised in rabbit using the N terminal of SREBF1 as the immunogen</p>

<p>Region of IL13 protein corresponding to amino acids MSPGPVPPST ALRELIEELV NITQNQKAPL CNGSMVWSIN LTAGMYCAAL ESLINVSGCS AIEKTQRMLS GFCPHKVSAG QFSSLHVRDT KIEVAQFVKD LLLHLKKLFR EGQFN.</p>

<p>GMPS antibody was raised in Rabbit using Human GMPS as the immunogen</p>

<p>MTHFD1L antibody was raised in Rabbit using Human MTHFD1L as the immunogen</p>

<p>CCT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE</p>

<p>SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM</p>

<p>Affinity purified Rabbit polyclonal CHRNA1 antibody</p>

<p>Rabbit Polyclonal WEE1 antibody (Ser642)</p>

<p>ODC antibody is a polyclonal antibody that specifically targets and binds to ornithine decarboxylase (ODC), a protein involved in the synthesis of polyamines. Polyamines play important roles in cell growth, proliferation, and differentiation. ODC antibody can be used in various applications in life sciences research, including the study of epidermal growth factor signaling pathways, autoantibodies associated with diseases such as heparin-induced thrombocytopenia, and the development of anti-HER2 antibody therapies. This antibody can also be used to detect ODC expression levels in different tissues or cell lines. The high specificity and sensitivity of ODC antibody make it an essential tool for researchers studying the role of polyamines in cellular processes and their potential as therapeutic targets.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC18A1 antibody, catalog no. 70R-8079</p>

<p>Rabbit polyclonal B4GALT3 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAS1 antibody, catalog no. 70R-7020</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Cyb5r4 antibody, catalog no. 70R-9449</p>

<p>Purified recombinant DPH3P1 protein (His tag)</p>

<p>Donkey anti-goat IgG was raised in donkey using goat IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal NMDAR2A antibody</p>

<p>Affinity purified Rabbit polyclonal LOC727787 antibody</p>

<p>Rabbit Polyclonal SEK1 antibody (Ser80)</p>

<p>The GPR116 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets GPR116, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting GPR116 in different experimental settings.</p>

<p>CD90 antibody (Azide free) was raised in rat using murine T-Cell hybridoma c6/G8, produced by fusion of porl insulin-specific BALB/c T cells with the AKR thymoma line BW 5147 as the immunogen.</p>

<p>Rabbit polyclonal PDCL antibody</p>

<p>Purified Polyclonal Histone Deacetylase 1 antibody</p>

<p>DKKL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH</p>

<p>CAMP antibody was raised in Rabbit using Human CAMP as the immunogen</p>

<p>Goat anti-mouse IgG/IgM (H+L) (HRP) was raised in goat using murine IgG and IgM whole molecules as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPEB4 antibody, catalog no. 70R-4969</p>

<p>Affinity purified Rabbit polyclonal RBM28 antibody</p>

<p>Methadone Conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP11B antibody, catalog no. 70R-6870</p>

<p>NUP155 antibody was raised using the N terminal of NUP155 corresponding to a region with amino acids MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA13 antibody, catalog no. 70R-1675</p>

<p>The SFRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly employed in immunohistochemistry studies to detect the presence of trpv4, an ion channel protein involved in various cellular processes. This antibody has been shown to be effective in neutralizing the activity of SFRP2, an endogenous inhibitor of trpv4. By blocking the interaction between SFRP2 and trpv4, this antibody allows for the activation of trpv4 and subsequent downstream signaling pathways. Additionally, this antibody has been found to inhibit the production of pro-inflammatory cytokines such as TNF-α and IFN-γ, making it a valuable tool in studying immune responses and inflammatory conditions like endotoxemia. Researchers can rely on this high-quality SFRP2 antibody to accurately detect and manipulate trpv4 activity in their experiments.</p>