Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.185 produtos)
- Por Alvo Biológico(99.150 produtos)
- Por uso/Efeitos Farmacológicos(6.789 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.764 produtos)
- Metabólitos secundários(14.307 produtos)
Foram encontrados 130581 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
FGF16 antibody
<p>FGF16 antibody was raised in goat using highly pure recombinant human FGF-16 as the immunogen.</p>Pureza:Min. 95%AP2A1 antibody
<p>AP2A1 antibody was raised in rabbit using the C terminal of AP2A1 as the immunogen</p>Pureza:Min. 95%KHDRBS1 antibody
<p>KHDRBS1 antibody was raised using the middle region of KHDRBS1 corresponding to a region with amino acids PPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSY</p>Pureza:Min. 95%SH2B1 antibody
<p>SH2B1 antibody was raised using the middle region of SH2B1 corresponding to a region with amino acids GTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSD</p>Pureza:Min. 95%CK2 α antibody
<p>CK2 alpha antibody was raised using the C terminal of CSNK2A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD</p>RAD17 antibody
<p>RAD17 antibody was raised in rabbit using residues 2-15 [NQVTDWVDPSFDDF] of the human RAD17 protein as the immunogen.</p>Pureza:Min. 95%OTUD6B antibody
<p>OTUD6B antibody was raised using the middle region of OTUD6B corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC</p>Pureza:Min. 95%Cytokeratin 16 antibody
<p>Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD</p>Influenza B nucleoprotein
<p>Influence B nucleoprotein is a chemokine that serves as a diagnostic agent in the field of Life Sciences. It interacts with sorafenib, a protein-coupled receptor, and antibodies to facilitate various biological processes. This recombinant protein plays a crucial role in the growth factor signaling pathway and is reactive towards aliphatic hydrocarbons. It has been found to be associated with interleukin-6 and mycoplasma genitalium. With its diverse functions, Influence B nucleoprotein holds great potential for research and diagnostic applications in the field of Proteins and Antigens.</p>Pureza:Min. 95%S6K1 antibody
<p>The S6K1 antibody is a highly effective inhibitor that specifically targets the S6 kinase 1 (S6K1) protein. This antibody is widely used in various research fields, including life sciences and molecular biology. It has been shown to effectively neutralize the activity of S6K1, which plays a crucial role in cell growth and proliferation.</p>Pureza:Min. 95%LOC652559 antibody
<p>LOC652559 antibody was raised using the middle region of Loc652559 corresponding to a region with amino acids EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL</p>Caspase 7 antibody
<p>The Caspase 7 antibody is a highly specific and sensitive tool for detecting the activated form of caspase 7, an enzyme involved in programmed cell death. This antibody recognizes the tyrosine residue at position 198 of the activated caspase 7 protein. It has been extensively validated in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>PTDSS1 antibody
<p>PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI</p>Pureza:Min. 95%HAUS8 antibody
<p>HAUS8 antibody was raised in rabbit using the N terminal of HAUS8 as the immunogen</p>Pureza:Min. 95%(2R,3S)-E1R
CAS:<p>(2R,3S)-E1R is a chiral chemical compound used in advanced research and pharmaceutical development. It is synthesized through a series of stereochemical reactions to ensure precise enantiomeric purity. The compound is typically derived from complex organic synthesis involving enantioselective catalysts, ensuring that its specific 2R,3S configuration is maintained.</p>Fórmula:C13H16N2O2Pureza:Min. 95%Peso molecular:232.28 g/molGLRX5 protein (His tag)
<p>1-157 amino acids: MGSSHHHHHH SSGLVPRGSH MSGSLGRAAA ALLRWGRGAG GGGLWGPGVR AAGSGAGGGG SAEQLDALVK KDKVVVFLKG TPEQPQCGFS NAVVQILRLH GVRDYAAYNV LDDPELRQGI KDYSNWPTIP QVYLNGEFVG GCDILLQMHQ NGDLVEELKK LGIHSALLDE KKDQDSK</p>Pureza:Min. 95%SPIC antibody
<p>SPIC antibody was raised in rabbit using the N terminal of SPIC as the immunogen</p>Pureza:Min. 95%Na+ Ca2+ Exchanger antibody
<p>Na, Ca Exchanger antibody was raised in mouse using purified canine cardiac Na/Ca exchanger as the immunogen.</p>REEP1 antibody
<p>REEP1 antibody was raised using the C terminal of REEP1 corresponding to a region with amino acids ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA</p>Pureza:Min. 95%GABARAPL1 antibody
<p>GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL</p>ZNF529 antibody
<p>ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogen</p>Pureza:Min. 95%
