Bioquímicos e reagentes

<p>The PTH antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and inhibit the action of parathyroid hormone (PTH), a hormone peptide involved in regulating calcium and phosphate levels in the body. This monoclonal antibody can be used as a powerful tool for studying the role of PTH in various biological processes.</p>

<p>ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL</p>

<p>Rabbit polyclonal CEB beta antibody (Thr235/188)</p>

<p>Protein C antibody was raised in sheep using mouse protein C as the immunogen.</p>

<p>PUMA antibody was raised in rabbit using 17 residue sequence 29-55 [EQHLESPVPSAPGALAG] found in the exon-3-encoded region in the human PUMA-Alpha and PUMA-Beta forms of the protein as the immunogen.</p>

<p>The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.</p>

<p>MYST1 antibody was raised using the N terminal of MYST1 corresponding to a region with amino acids MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGE</p>

<p>Purified Rabbit polyclonal VEGFR2 antibody (Tyr1059)</p>

<p>Purified Polyclonal Cytochrome P450 11A1 antibody</p>

<p>Olaquindox Conjugate for use in immunoassays</p>

<p>SHMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG</p>

<p>Rat monoclonal CX3CR1 antibody (biotin)</p>

<p>The OCT2 antibody is a highly effective monoclonal antibody that is used in Life Sciences research. This antibody specifically targets and binds to the OCT2 protein, which is a key player in various cellular processes. By forming an antibody complex with OCT2, this antibody inhibits the activity of protein kinases and other enzymes involved in cellular signaling pathways.</p>

<p>The ACLY antibody is a monoclonal antibody that specifically targets and inhibits the activity of ACLY (ATP citrate lyase), an enzyme involved in fatty acid synthesis. This antibody has been shown to reduce the viscosity of monoclonal antibodies, making it a valuable tool for improving the formulation and stability of therapeutic antibodies. In addition to its role in fatty acid synthesis, ACLY has also been implicated in various cellular processes, including epidermal growth factor signaling, chemokine production, and interleukin-6 expression. By targeting ACLY with this specific antibody, researchers can gain insights into its function and potential as a therapeutic target. The ACLY antibody is highly specific and exhibits low cross-reactivity with other proteins, making it an ideal choice for research applications.</p>

<p>HS2ST1 antibody was raised in Rabbit using Human HS2ST1 as the immunogen</p>

<p>ZNF409 antibody was raised in rabbit using the middle region of ZNF409 as the immunogen</p>

<p>CD4 antibody (PE) was raised in mouse using CD4+ transfectant/human CEM as the immunogen.</p>

<p>Rabbit polyclonal OR10J1 antibody</p>

<p>317-546 amino acids: MGSSHHHHHH SSGLVPRGSH MEGKEEPGSD SGTTAVVALI RGKQLIVANA GDSRCVVSEA GKALDMSYDH KPEDEVELAR IKNAGGKVTM DGRVNGGLNL SRAIGDHFYK RNKNLPPEEQ MISALPDIKV LTLTDDHEFM VIACDGIWNV MSSQEVVDFI QSKISQRDEN GELRLLSSIV EELLDQCLAP DTSGDGTGCD NMTCIIICFK PRNTAELQPE SGKRKLEEVL STEGAEENGN SDKKKKAKRD</p>

<p>KNG1 antibody was raised using the middle region of KNG1 corresponding to a region with amino acids YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK</p>

<p>Rabbit polyclonal CEP57 antibody</p>

<p>Rabbit polyclonal BCL2 antibody (Thr56)</p>

<p>RNF167 antibody was raised in rabbit using the middle region of RNF167 as the immunogen</p>

<p>Rabbit polyclonal SREBF2 antibody</p>

<p>Rabbit polyclonal SCYL2 antibody</p>

<p>GFP antibody was raised in mouse using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.</p>

<p>Rabbit polyclonal DFFA antibody</p>

<p>LDHB antibody was raised in Rabbit using Human LDHB as the immunogen</p>

<p>Recombinant PPAP protein</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>Vaspin antibody was raised in mouse using recombinant human Vaspin (21-414aa) purified from E. coli as the immunogen.</p>

<p>Purified recombinant UGT8 protein (His tag)</p>

<p>VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN</p>

<p>Recombinant human IL-6</p>

<p>The Nuclear Pore Complex antibody is a highly specific monoclonal antibody designed for use in Life Sciences research. It is used to detect and study the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. This antibody binds specifically to proteins within the nuclear pore complex, allowing researchers to visualize and study its function.</p>

<p>Rabbit polyclonal TSPAN7 antibody</p>

<p>YARS antibody was raised in mouse using recombinant Tyrosyl-Trna Synthetase (Yars)</p>

<p>TSH beta protein is a native protein that belongs to the group of proteins and antigens. It is commonly used in life sciences research, particularly in studies related to colony-stimulating factors. TSH beta protein has been shown to have various functions, including the regulation of metabolism and growth. It can interact with other molecules such as flavobacterium, glucagon, monoclonal antibodies, and inhibitors. Additionally, TSH beta protein has been found to play a role in adipose tissue function and the production of growth factors like GM-CSF (granulocyte-macrophage colony-stimulating factor). Researchers often utilize TSH beta protein in experiments involving electrodes and anti-MERTK antibodies due to its unique properties and interactions.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>PAFAH1B3 antibody was raised using the middle region of PAFAH1B3 corresponding to a region with amino acids GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN</p>

<p>Purified Rabbit polyclonal LYAR antibody</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN</p>

<p>The CD2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It interacts with CD2, a cell surface glycoprotein expressed on T cells, natural killer cells, and thymocytes. This antibody has been extensively studied for its potential applications in various areas of research.</p>

<p>Rabbit polyclonal CTCFL antibody</p>

<p>C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI</p>

<p>PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains, leading to cell growth inhibition in culture.</p>

<p>SLC39A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS</p>