Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.179 produtos)
- Por Alvo Biológico(99.902 produtos)
- Por uso/Efeitos Farmacológicos(6.790 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.846 produtos)
- Metabólitos secundários(14.327 produtos)
Foram encontrados 130590 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Aquaporin 10 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AQP10 antibody, catalog no. 70R-7450</p>Pureza:Min. 95%STS antibody
<p>STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW</p>PTDSS1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTDSS1 antibody, catalog no. 70R-6873</p>Pureza:Min. 95%Chlorodenafil
CAS:<p>Chlorodenafil is an analog of tadalafil, a PDE-5 inhibitor. It is used in the treatment of erectile dysfunction. The safety and efficacy of chlorodenafil have not been established. This drug is not recommended for use by patients with severe hepatic impairment or those who are taking medicines that inhibit CYP3A4. Chlorodenafil should not be used with other PDE-5 inhibitors, such as sildenafil and vardenafil, because this can lead to a serious decrease in blood pressure.<br>Chlorodenafil has been investigated for its possible role in the treatment of dyslipidemia and insulin resistance; however, it has not been approved for these indications.</p>Fórmula:C19H21ClN4O3Pureza:Min. 95%Peso molecular:388.8 g/molAnnexin A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA11 antibody, catalog no. 70R-1702Pureza:Min. 95%FOXO3A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FOXO3A antibody, catalog no. 70R-8237</p>Pureza:Min. 95%CCNG1 antibody
<p>CCNG1 antibody was raised in rabbit using the N terminal of CCNG1 as the immunogen</p>HPSE antibody
<p>HPSE antibody was raised in rabbit using the N terminal of HPSE as the immunogen</p>Guinea Pig Serum Albumin antibody (FITC)
<p>Rabbit polyclonal Guinea Pig Serum Albumin antibody (FITC)</p>PAIP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP1 antibody, catalog no. 70R-1375</p>Pureza:Min. 95%NLRP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NLRP1 antibody, catalog no. 70R-2731</p>Pureza:Min. 95%Follistatin antibody
<p>The Follistatin antibody is a monoclonal antibody that targets and binds to Follistatin, a protein involved in various biological processes. Follistatin plays a crucial role in regulating the activity of growth factors such as glucagon and colony-stimulating factors (CSFs). By binding to Follistatin, this antibody inhibits its function and prevents it from interacting with its binding proteins. This inhibition can have several effects on different systems in the body.</p>BXDC2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BXDC2 antibody, catalog no. 70R-9483</p>Pureza:Min. 95%OSMR Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OSMR antibody, catalog no. 70R-7384</p>Pureza:Min. 95%DDX21 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX21 antibody, catalog no. 70R-1368</p>Pureza:Min. 95%ILF3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA9 antibody, catalog no. 70R-8082</p>Pureza:Min. 95%PGBD3 antibody
<p>PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT</p>GFPT2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFPT2 antibody, catalog no. 70R-3650</p>Pureza:Min. 95%PPME1 antibody
<p>PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF</p>Thrombopoietin antibody
<p>Thrombopoietin antibody is a highly specialized antibody that is used in the field of life sciences. It is designed to target and bind to thrombopoietin, a protein found in human serum. This antibody plays a crucial role in regulating platelet production and function.</p>RAD23B antibody
<p>RAD23B antibody was raised using a synthetic peptide corresponding to a region with amino acids QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP</p>CUGBP2 antibody
<p>CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV</p>PAFAH1B1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAFAH1B1 antibody, catalog no. 70R-5659</p>Pureza:Min. 95%CEACAM19 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM19 antibody, catalog no. 70R-6300</p>Pureza:Min. 95%TANK Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TANK antibody, catalog no. 70R-8258</p>Pureza:Min. 95%KNG1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KNG1 antibody, catalog no. 70R-2920</p>Pureza:Min. 95%LHC-165
CAS:<p>LHC-165 is a biodegradable polymer drug that targets the tumor microenvironment. LHC-165 has been shown to induce myeloid-derived suppressor cells (MDSCs) and inhibit TGF-β signaling. MDSCs are immunosuppressive cells that have been implicated in tumor progression and resistance to therapy, as well as in postoperative recurrence of cancer. The mechanism of action of LHC-165 is mediated by toll-like receptor 4 (TLR4) activation. This leads to an intratumoral accumulation of MDSCs and an intraoperative reduction in their number. In addition, LHC-165 has been shown to be effective for the treatment of colorectal cancer when used with resection or radiation therapy.</p>Fórmula:C29H32F2N3O7PPureza:Min. 95%Peso molecular:603.55 g/molLeptin Mouse
<p>Leptin is a peptide hormone that is produced by adipocytes and regulates appetite. Leptin binds to the leptin receptor, which is found in many tissues including the hypothalamus. The receptor activates an intracellular second messenger system that includes the protein kinase JAK2, leading to the activation of STAT3 transcription factor. Leptin has been shown to inhibit ion channels and activate or block receptors, depending on the type of cell it binds with.</p>Pureza:Min. 95%SCARB2 antibody
<p>SCARB2 antibody was raised in rabbit using the N terminal of SCARB2 as the immunogen</p>OR1G1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR1G1 antibody, catalog no. 70R-9851</p>Pureza:Min. 95%VEGFR2 antibody
<p>The VEGFR2 antibody is a polyclonal antibody that specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2). This receptor plays a crucial role in angiogenesis, which is the process of new blood vessel formation. The VEGFR2 antibody can be used in various life science applications to study the activation and signaling of this important growth factor.</p>TNF Receptor Type II antibody
<p>TNF receptor type II antibody was raised in rabbit using highly pure recombinant human sTNF-receptor II as the immunogen.</p>Pureza:Min. 95%Rabbit anti Chicken IgG (FITC)
<p>Rabbit anti-chicken IgG (FITC) was raised in rabbit using chicken IgG F(c) fragment as the immunogen.</p>Pureza:Min. 95%MRE11A antibody
<p>The MRE11A antibody is a highly specific monoclonal antibody that is used in various research applications in the field of Life Sciences. This antibody specifically targets the MRE11A protein, which plays a crucial role in DNA repair and maintenance. It has been widely used in studies related to amyloid plaque formation, anti-angiogenesis, alpha-fetoprotein detection, and growth factor signaling pathways.</p>Galectin 1 protein
<p>1-135 amino acids: MACGLVASNL NLKPGECLRV RGEVAPDAKS FVLNLGKDSN NLCLHFNPRF NAHGDANTIV CNSKDGGAWG TEQREAVFPF QPGSVAEVCI TFDQANLTVK LPDGYEFKFP NRLNLEAINY MAADGDFKIK CVAFD</p>Pureza:Min. 95%WNT3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT3 antibody, catalog no. 70R-4494</p>Pureza:Min. 95%Histone H2B antibody
<p>The Histone H2B antibody is a highly specific monoclonal antibody that is derived from plasma. It is commonly used in Life Sciences research to study various cellular processes, including chromatin remodeling and gene expression regulation. This antibody has been shown to have high affinity and specificity for Histone H2B, a protein involved in DNA packaging within the cell nucleus.</p>Testosterone 19 antibody
<p>Testosterone 19 antibody was raised in rabbit using testosterone-19-HSA as the immunogen.</p>Pureza:Min. 95%
