Bioquímicos e reagentes

<p>Rabbit polyclonal NRBP2 antibody</p>

<p>Sheep anti-rabbit IgG (H+L) was raised in sheep using rabbit IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPD antibody, catalog no. 70R-7513</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLCN antibody, catalog no. 70R-10330</p>

<p>H-2Db antibody (PE) was raised in mouse using C57B/10 mouse skin graft and splenocytes as the immunogen.</p>

<p>CSK antibody was raised in Rabbit using Human CSK as the immunogen</p>

CD8 antibody was raised in Mouse using a purified recombinant fragment of human CD8 expressed in E. coli as the immunogen.

<p>The CXCL1 antibody is a powerful tool in the field of Life Sciences. It functions as a growth factor and has been shown to interact with epidermal growth factor receptors, protein kinases, and phosphatases. This monoclonal antibody exhibits cytotoxic properties and can be used for various applications in research and diagnostics.</p>

<p>The Apolipoprotein E4 Antibody is a highly specialized monoclonal antibody that targets and neutralizes the effects of Apolipoprotein E4 (APOE4). APOE4 is a human protein that has been associated with various health conditions, including Alzheimer's disease and cardiovascular disorders. This antibody specifically binds to APOE4, preventing its interaction with other molecules in the body.</p>

<p>Region of Exodus 2 protein corresponding to amino acids SDGGGQDCCL KYSQKKIPYS IVRGYRKQEP SLGCPIPAIL FLPRKHSKPE LCANPEEGWV QNLMRRLDQP PAPGKQSPGC RKNRGTSKSG KKGKGSKGCK RTEQTQPSRG.</p>

<p>SPACA1 antibody was raised in rabbit using the N terminal of SPACA1 as the immunogen</p>

<p>Rabbit polyclonal CD249 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LSM4 antibody, catalog no. 70R-4945</p>

<p>60 nm Colloidal Gold particle suspension</p>

<p>ELF2 antibody was raised in Rabbit using Human ELF2 as the immunogen</p>

<p>10 µg/ml in stabilizer; for use in immunoassays</p>

<p>METT10D antibody was raised in rabbit using the N terminal of METT10D as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR73 antibody, catalog no. 70R-10151</p>

<p>Factor VII antibody was raised in mouse using human factor VII as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GABRG2 antibody, catalog no. 70R-1545</p>

<p>The PCTK1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the alpha-fetoprotein (AFP), a protein commonly associated with liver development and certain types of cancer. This antibody has been extensively tested and validated for its specificity and sensitivity in various experimental settings.</p>

<p>Purified recombinant Human HSPB2 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H2AFY antibody, catalog no. 70R-2114</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RER1 antibody, catalog no. 70R-6861</p>

<p>Rabbit polyclonal SMG7 antibody</p>

<p>Purified Rabbit polyclonal U12 antibody</p>

<p>PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW</p>

<p>Purified recombinant Mouse CXCL3 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vps45 antibody, catalog no. 70R-9174</p>

<p>Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.</p>

<p>The Tenascin antibody is a highly specialized recombinant protein that belongs to the class of chemokines. It is designed to target specific antigens and has been extensively studied in the field of Life Sciences. This antibody exhibits strong binding affinity towards glycoproteins, making it an ideal tool for research purposes. It has also been used in studies related to hyperammonemia and shows promising results in inhibiting the growth of cancer cells, such as MCF-7. The Tenascin antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its ability to effectively neutralize target proteins, this antibody holds great potential for therapeutic applications, including the development of antibody-drug conjugates. Whether you're conducting cutting-edge research or exploring new avenues in drug discovery, the Tenascin antibody is a valuable tool that can significantly contribute to your scientific endeavors.</p>

<p>Purified Rabbit polyclonal TAS2R43 antibody</p>

<p>CD31 antibody was raised in mouse using PECAM-1 (CD31) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACBD6 antibody, catalog no. 70R-10059</p>

<p>EPHX2 antibody was raised in Rabbit using Human EPHX2 as the immunogen</p>

<p>C14orf129 antibody was raised in rabbit using the middle region of C14orf129 as the immunogen</p>

<p>Purified recombinant Human NRK1 Protein (His tag)</p>

<p>The GLUT1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the glycoprotein GLUT1, which plays a crucial role in glucose transport across cell membranes. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MED4 antibody, catalog no. 70R-8935</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUCB2 antibody, catalog no. 70R-1577</p>

<p>ASAH1 antibody was raised in Rabbit using Human ASAH1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM4 antibody, catalog no. 70R-7236</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLAIN2 antibody, catalog no. 70R-3044</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DTL antibody, catalog no. 70R-2405</p>

<p>The CD22 antibody is a glycoprotein that belongs to the group of polyclonal antibodies. It is commonly used in the field of Life Sciences for research purposes. The CD22 antibody specifically targets CD22, a cell surface protein expressed on B cells. It has been shown to inhibit the growth and proliferation of B cells by binding to CD22 and blocking its function. This antibody has also been found to have anti-inflammatory properties, as it can reduce the levels of pro-inflammatory cytokines such as TGF-beta and TNF-alpha. Additionally, the CD22 antibody has been shown to modulate microvessel density, collagen synthesis, and hyaluronidase activity. Overall, this antibody is a valuable tool for studying B cell biology and exploring potential therapeutic applications in various diseases.</p>

<p>The YAP1 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences due to its ability to target specific proteins and molecules. This antibody has shown promising results in inhibiting the activation of fibrinogen, which is involved in blood clotting. Additionally, it has been found to interact with statins, chemical agents that are commonly used for cholesterol management, and modulate their effects.</p>

Sheep anti-rabbit IgG (H+L) (Alk Phos) was raised in sheep using rabbit IgG whole molecule as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf62 antibody, catalog no. 70R-5266</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL11 antibody, catalog no. 70R-7879</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOL6 antibody, catalog no. 70R-4744</p>