Bioquímicos e reagentes

<p>Rat pan T cell antibody (biotin) was raised in mouse using rat lymphocytes as the immunogen.</p>

<p>Region of Flt Ligand protein corresponding to amino acids TQDCSFQHSP ISSDFAVKIR ELSDYLLQDY PVTVASNLQD EELCGGLWRL VLAQRWMERL KTVAGSKMQG LLERVNTEIH FVTKCAFQPP PSCLRFVQTN ISRLLQETSE QLVALKPWIT RQNFSRCLEL QCQPDSSTLP PPWSPRPLEA TAPTA.</p>

<p>Nocloprost is a synthetic analog of prostaglandin F2α. It is a specific agonist for the prostaglandin receptor, which is found in the epidermal growth factor, protein data, and hematopoietic cells. Nocloprost is taken up by these cells and causes an increase in cytosolic calcium levels. This leads to activation of pancreatic enzymes and hydrochloric acid production. The chemical name for nocloprost is 4-oxo-1-(2-propenyl)-5-(3-phenylpropyl)penta-1,4-dienoic acid methyl ester. The molecular formula is C14H22O3 with a molecular weight of 258.34 g/mol.</p>

<p>GDC-0575 is a potent, selective, and orally available inhibitor of the voltage-gated potassium channel Kv1.3. It has been shown to inhibit Kv1.3 in both native and recombinant systems with an IC50 of less than 1 nM for both channels. GDC-0575 has been shown to have no effect on other voltage-gated ion channels tested, such as Kv2.1 and Kv4.2, which are expressed in many tissues including the brain, heart, and skeletal muscle. GDC-0575 is also selective for Kv1.3 over other closely related ion channels such as Kv4.2 and Shaker B channels (Kv1) with inhibition constants in the low nanomolar range.</p>

<p>Cav 2.2 blocker 1 is a hydroxylated flavonol that is an inhibitor of the Cav 2.2 channel. It has been shown to have potent anthelmintic activity in vitro, and it may also have antiangiogenic properties in vivo. Cav 2.2 blocker 1 has been shown to inhibit the proliferation of HL-60 cells by blocking the apoptosis pathway, and it inhibits the invasion of human hepatoma cells in vitro. The structural analysis of Cav 2.2 blocker 1 revealed that this compound binds to group P2 of the ATP binding site on the Cav 2.2 channel, which is located in a hydrophobic pocket formed by three phenylalanine residues at positions 325, 327, and 329 on subunit A (P325A/P327A/P329A). This binding mode is similar to that observed for other inhibitors of the Cav 2.2 channel such as 3-o-caffeoylquinic acid and N</p>

ICI 89406 is an analytical agent that binds to the 2-adrenergic receptor. Binding of ICI 89406 to this receptor leads to a reduction in the levels of cAMP and activation of protein kinase A, which regulates glucose uptake, thermogenesis, and cardiac function. ICI 89406 has also been shown to bind to guanine nucleotide-binding proteins that regulate binding of GTP, thereby inhibiting transcription-polymerase chain reaction (PCR) activity. This drug has affinity constants for both the heart and adrenal gland tissues. It is selective for the 2-adrenergic receptor and does not bind to other receptors such as those for serotonin or dopamine.

<p>Please enquire for more information about (4E)-5-(4-Hydroxyphenyl)-2-[(2E)-3-(4-hydroxyphenyl)-1-oxo-2-propen-1-yl]-3-oxo-N-phenyl-4-pentenamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MKC 9989 is a small molecule that is designed to target cancer cells. It has been shown to cause cell dysfunction by binding to lysine residues on the surface of cancer cells and removing proton from the cell, which impairs its ability to function. MKC 9989 also binds to hydrogen bonds on the surface of cancer cells and prevents them from forming imines, which are important for cellular metabolism. This drug has been shown to be effective in treating cancers in animal models and may be used as an alternative treatment option for patients who have not responded well to other therapies such as chemotherapy or radiation therapy.</p>

<p>Inhibitor of checkpoint kinase CHK1</p>

<p>C8 Ceramide (d17:1/8:0) is a synthetic analog of natural ceramide, which is a type of sphingolipid. It is derived through chemical synthesis, mimicking the structure of naturally occurring ceramides found in cell membranes and the stratum corneum of the skin. The product incorporates a short acyl chain, which affects its solubility and facilitates specific experimental applications.</p>

<p>The 1-morpholino-1-(thiophen-2-yl)propane-2-yl)-3-(2-(trifluoromethoxy)phenyl)thiourea (MTT) is a research tool, which is used as an activator, ligand, receptor or cell biology. It has been shown to inhibit ion channels and cause changes in the properties of protein interactions. The MTT has also been shown to be an inhibitor of peptides.</p>

<p>16:0-18:0-16:0 d5 Tg is a synthetic tracer peptide that inhibits the activity of ligand binding to receptor. It can be used in pharmacology, protein interactions, and cell biology research. 16:0-18:0-16:0 d5 Tg has an amino acid sequence of Ac-KLHILPYKLNQVSVTRKGSTLTVSS and is made up of 16% leucine, 18% valine, and 16% threonine. This tracer peptide has a molecular weight of 607 Daltons and a purity level of &gt; 98%. It is soluble in water and has a shelf life of one year.</p>

<p>Edaglitazone is a drug used for the treatment of type 2 diabetes. It belongs to the class of thiazolidinedione drugs, which are insulin sensitizers. Edaglitazone has shown anti-inflammatory properties and may be useful in treating inflammatory diseases such as rheumatoid arthritis. This drug can also be used as a diagnostic tool to measure insulin sensitivity in humans by measuring erythrocyte glucose uptake. Edaglitazone has been shown to inhibit tumor growth and induce apoptosis in cancer cells, but not healthy cells, in animal models.</p>

<p>The MYPT1 antibody is a highly specific monoclonal antibody that targets the phosphatase, oncogene homolog protein. It plays a crucial role in various cellular processes, including cell growth and differentiation. This antibody recognizes the tetramerization domain of MYPT1 and has been shown to be effective in detecting MYPT1 expression in cutaneous systemic sclerosis.</p>

<p>Alpha 1 Microglobulin protein is a native protein found in human serum. It can be used as an electrode to detect the presence of steroids, adeno-associated virus, and other proteins and antigens. This protein can also serve as a target molecule for the development of inhibitors or monoclonal antibodies. Studies have shown that alpha 1 Microglobulin protein interacts with β-catenin and plays a role in cell signaling pathways. Additionally, it has been identified as an oncogene homolog and may be involved in various processes related to cancer development. Researchers in the field of life sciences can utilize this protein for further studies and experiments.</p>

<p>1-133 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMVD AFLGTWKLVD SKNFDDYMKS LGVGFATRQV ASMTKPTTII EKNGDILTLK THSTFKNTEI SFKLGVEFDE TTADDRKVKS IVTLDGGKLV HLQKWDGQET TLVRELIDGK LILTLTHGTA VCTRTYEKEA</p>

<p>BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant HSFY1 protein (His tag)</p>

<p>Sheep polyclonal JWH 018 antibody</p>

<p>MIA2 antibody was raised in rabbit using human highly pure recombinant human MIA-2 as the immunogen.</p>

The IpaD antibody is a nuclear monoclonal antibody that targets various antigens in the body. It has been specifically designed to bind to alpha-fetoprotein, collagen, phosphatase, and sclerostin. This antibody is widely used in Life Sciences research for its ability to detect and measure the presence of these antigens in samples such as human serum.

<p>Endostatin antibody was raised in Mouse using recombinant endostatin as the immunogen.</p>

<p>TNRC6B antibody was raised using the N terminal of TNRC6B corresponding to a region with amino acids YVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAV</p>

<p>PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE</p>

<p>WNT3A antibody was raised using the N terminal of WNT3A corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP</p>

<p>MIP3 antibody was raised in rabbit using highly pure recombinant human MIP-3 as the immunogen.</p>

<p>Rabbit Polyclonal CLN6 antibody</p>

<p>WNT2 antibody was raised using the middle region of WNT2 corresponding to a region with amino acids GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR</p>

<p>The Histone H3 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets histone H3, a protein involved in gene regulation and chromatin structure. This antibody can be used to detect and quantify histone H3 levels in various biological samples, such as human serum or cell lysates.</p>

<p>The MMP8 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to matrix metalloproteinase 8 (MMP8). MMP8 is an enzyme that plays a crucial role in collagen degradation. This antibody can be used for various applications, including cytotoxicity assays, immunohistochemistry, and Western blotting.</p>

<p>FUNDC1 antibody was raised using the middle region of FUNDC1 corresponding to a region with amino acids TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN</p>

<p>Purified Polyclonal Mammaglobin B antibody</p>

<p>DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC</p>

<p>Purified recombinant GZMK protein (His tag)</p>

<p>Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE</p>

MTMR4 antibody was raised in Rabbit using Human MTMR4 as the immunogen

<p>Rabbit polyclonal TMEM70 antibody</p>

<p>The B7H4 antibody is a monoclonal antibody that targets the B7H4 protein, which is expressed on the surface of tumor cells. This antibody has been shown to have potent anti-tumor activity and can effectively inhibit tumor growth. It works by blocking the interaction between B7H4 and its receptor, preventing the suppression of immune responses against tumor cells. In addition, the B7H4 antibody has been found to enhance the production of interferon-gamma (IFN-gamma) and interleukin-6 (IL-6), which are important cytokines involved in immune regulation. This antibody is highly specific for human B7H4 and does not cross-react with other proteins. It has been extensively tested in various preclinical models and has shown promising results in terms of efficacy and safety. The B7H4 antibody is a valuable tool for researchers in the field of Life Sciences who are studying tumor immunology and developing novel cancer therapies.</p>

<p>Rabbit polyclonal MNK1 antibody</p>

<p>PF4 antibody was raised in rabbit using highly pure recombinant hPF-4 as the immunogen.</p>

<p>CHSY2 antibody was raised using the N terminal Of Chsy-2 corresponding to a region with amino acids PPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGGAAGQRRDGRPGSSHNG</p>

<p>Purified Polyclonal TNF beta antibody</p>

Rabbit polyclonal IL8 antibody (biotin)

<p>1-171 amino acids: MGSSHHHHHH SSGLVPRGSH MAKFVIRPAT AADCSDILRL IKELAKYEYM EEQVILTEKD LLEDGFGEHP FYHCLVAEVP KEHWTPEGHS IVGFAMYYFT YDPWIGKLLY LEDFFVMSDY RGFGIGSEIL KNLSQVAMRC RCSSMHFLVA EWNEPSINFY KRRGASDLSS EEGWRLFKID KEYLLKMATE E</p>

<p>Biotin conjugated Rabbit polyclonal Ovalbumin antibody</p>

<p>TrkC antibody was raised in goat using the entire extracellular domain of rat TrkC receptor as the immunogen.</p>

<p>The EGFL6 antibody is a highly specialized antibody that targets the steroid hormone β-catenin. It is available in both polyclonal and monoclonal forms, making it suitable for various research applications. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy.</p>

<p>BTN2A1 antibody was raised in Rabbit using Human BTN2A1 as the immunogen</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>