Bioquímicos e reagentes

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VVLPISIYAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Fmoc-Ile-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NITEIADLTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.</p>

<p>TIMP2 antibody was raised in rabbit using a synthetic peptide based on the carboxy-terminus of the human TIMP-2 sequence as the immunogen.</p>

<p>Peptide LCBiot-RRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-KRFRQFKQAV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRFRQFKQAV-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRFRQFKQAV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRFRQFKQAV-OH at the technical inquiry form on this page</p>

<p>Peptide H-ALPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-RHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-IHIHIYI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Surfactant 10G is a versatile product widely used in the Life Sciences industry. It acts as a drug antibody and is commonly used in buffers for neutralizing purposes. Surfactant 10G has been proven to effectively regulate plasma levels of teriparatide, fibrinogen, and alpha-gal antibodies. It is also a reliable test substance for monoclonal antibodies and phosphatase binding proteins.</p>

<p>Orexin A is a neuropeptide that regulates the sleep-wake cycle and controls appetite. It has been shown to have a role in modulating the immune system, blood pressure, and energy metabolism. Orexin A is expressed in neurons and other cells in the brain, including astrocytes. It has been shown to regulate neuronal death by inhibiting pro-death signals such as caspase-3, which are released in response to stress or injury. Orexin A also interacts with toll-like receptors and receptor activity, which may be responsible for its effects on inflammatory responses.</p>

<p>Terfenadine is an antihistamine drug that is used for the treatment of allergy symptoms such as edema and flare ups. This drug is a histamine receptor antagonist and competes with histamine for binding with the H1 receptor. It occurs at sites such as the GI tract, uterus and blood vessels.</p>

<p>Peptide H-YGFIEGHVVIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SKISASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CA 125 antibody was raised in mouse using purified human ovarian mucin antigen from ascites as the immunogen.</p>

<p>Cortisol 3 antibody was raised in mouse using 3-CMO-BSA as the immunogen.</p>

<p>H-HSGRLAGRGGPEDGGLGA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HSGRLAGRGGPEDGGLGA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HSGRLAGRGGPEDGGLGA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HSGRLAGRGGPEDGGLGA-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-ADSNPRGVSAALSRPSPGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ADSNPRGVSAALSRPSPGGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ADSNPRGVSAALSRPSPGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ADSNPRGVSAALSRPSPGGC-OH at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been proven through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it has the ability to bind to markers expressed in high levels in Mycobacterium tuberculosis strains and inhibit cell growth in culture.</p>

<p>Ac-CDTSTEYSEVRTQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CDTSTEYSEVRTQ-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CDTSTEYSEVRTQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CDTSTEYSEVRTQ-OH at the technical inquiry form on this page</p>

<p>MK 886 is a leukotriene antagonist that has been studied for use in treating atherosclerosis. This drug inhibits the 5-lipoxygenase activating protein thus inhibiting 5-lipoxygenase.</p>

<p>Mouse IgG1 kappa light chain antibody was raised in rat using murine IgG kappa as the immunogen.</p>

<p>R428 is a small-molecule drug that is capable of inhibiting the BCR-ABL kinase and blocking the progression of chronic myelogenous leukemia. It has been shown to be effective in both in vitro and in vivo studies, with reduced toxicity compared to other treatments. R428 has been shown to inhibit proliferation of breast cancer cells in vitro and reduce the size of solid tumours in mice. This drug also inhibits epithelial mesenchymal transition (EMT) from epithelial cells to mesenchymal cells, which may be a potential mechanism for its anticancer activity.</p>

<p>H-VTGYRLFEEIL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTGYRLFEEIL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTGYRLFEEIL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTGYRLFEEIL-OH at the technical inquiry form on this page</p>

<p>BMH-23 is a small molecule compound, which is derived from chemical synthesis. It functions primarily as an inhibitor targeting the interaction between the p53 tumor suppressor protein and MDM2, a critical negative regulator of p53. This selective inhibition leads to the stabilization and activation of p53, resulting in the induction of cell cycle arrest and apoptosis in p53-functional cancer cells.</p>

<p>Sheep polyclonal Creatinine N antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>GLS antibody was raised using the middle region of GLS corresponding to a region with amino acids VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT</p>

<p>Peptide H-YNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Influenza B antibody was raised in mouse using a nuclear protein from the Singapore strain of influenza B as the immunogen.</p>

<p>HPV, Type 18, E7 Oncoprotein Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HPV, Type 18, E7 Oncoprotein Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Neutrophil Gelatinase-Associated Lipocalin (NGAL) Rabbit Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Neutrophil Gelatinase-Associated Lipocalin (NGAL) Rabbit Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Kappa Free Light Chain Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Kappa Free Light Chain Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-VYI^HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Sheep polyclonal DHEA Sulphate antibody</p>

<p>Peptide H-ASGPGGGAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal E. coli antibody (K99 Pilus)</p>

<p>Selective inhibitor of the Src kinase family with subnanomolar IC50 values and good selectivity over c-Abl, PDGFRα and c-Kit kinases. The compound is effective in inhibiting growth in drug resistant cancer cell lines. In a recent study, it inhibited the growth of HER2-positive breast cancer cell lines which were resistant to pan-HER family kinase inhibitors such as lapatinib.</p>

<p>RET receptor tyroine kinase inhibitor</p>

<p>H-LPPFLFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPPFLFT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPPFLFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPPFLFT-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-PFEFVSSPAGNTSVM-cysteamide is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PFEFVSSPAGNTSVM-cysteamide is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PFEFVSSPAGNTSVM-cysteamide in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PFEFVSSPAGNTSVM-cysteamide at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RLLVP^TQFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>