Bioquímicos e reagentes

<p>Please enquire for more information about Bordetella Pertussis Whole Cell Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lipase protein is an essential enzyme that plays a crucial role in lipid metabolism. It acts as both lipoprotein lipase and triglyceride lipase, breaking down triglycerides into fatty acids and glycerol. This protein is involved in various biological processes, including growth hormone receptor signaling, growth factor regulation, and immune response modulation.</p>

<p>Influenza B antibody was raised in mouse using Influenza B as the immunogen.</p>

<p>Peptide H-RFVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified Polyclonal ABCA7 antibody</p>

<p>G6PDH antibody was raised in rabbit using residues 50-100 of human glucose-6-phosphate dehydrogenase as the immunogen.</p>

<p>Yellow fever virus NS1 antigen for diagnostic test manufacturers, vaccine developers and researchers globally. This His-tagged, recombinant protein is expressed in HEK293 cells and is derived from strain 17D. Yellow fever virus, a potentially fatal mosquito-borne flavivirus, is prevalent in tropical and subtropical locations in South America and Africa. Yellow fever virus is transmitted to humans mainly by sylvatic mosquito vectors of the genera Haemagogus and Sabethes, but has also been known to be spread by the sinister Aedes aegypti mosquito which is responsible for the current Zika virus epidemic. In humans, the majority of yellow fever infections are asymptomatic; however approximately 15% of infected patients enter what is known as the toxic phase and this can lead to severe complications such as jaundice, multi-organ failure and even death. There is no specific treatment for Yellow fever and, despite access to safe and effective vaccines, the virus is still causing significant health problems in these countries.Laboratory diagnosis is generally accomplished by means of serological testing for the detection of antibodies during the postviremic phase of the disease (i.e. from the 5th day since the onset of symptoms). Yellow fever virus is difficult to diagnose, especially in the early stages, as cross-reaction with other flavivirus infections is common. There are no validated IgM ELISA kits commercially available at present and in order for yellow fever infection to be confirmed by serologically techniques, a differential diagnosis with other flavivirus infections must be carried out.Cymit Quimica's yellow fever virus protein will provide the critical element to further diagnostic companies’ research and development of IgG and potentially IgM assays.</p>

<p>Mycoplasma Pneumoniae IgM Negative Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Mycoplasma Pneumoniae IgM Negative Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Progesterone 4 Conjugate for use in immunoassays</p>

<p>Please enquire for more information about Luteinizing Hormone (LH), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide Cbz-LR-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ITQSNAILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Hemoglobin antibody was raised in mouse using human hemoglobin as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Alpha-2-Macroglobulin, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Alpha-2-Macroglobulin, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Procalcitonin (PCT), Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Procalcitonin (PCT), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Potent inhibitor of mitotic spindle 1 (MSP1) kinase. MPS1 is a component of the spindle assembly checkpoint and is therefore involved in mitosis. Targeting MSP1 kinases has therapeutic applications in cancer and data suggests good efficacy in vivo when combining BOS 172722 with paclitaxel.</p>

<p>Goat anti Human IgG (H + L) secondary antibody</p>

<p>Mouse monoclonal Apurinic/Apyrimidinic Endonuclease antibody</p>

<p>Cardiolipin Antibody/B2G IgG/IgM Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Cardiolipin Antibody/B2G IgG/IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Activator of p53; inhibitor of NF-?B</p>

<p>H-ARIKEKIEE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ARIKEKIEE-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ARIKEKIEE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ARIKEKIEE-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified native Human Pepsinogen II protein</p>

<p>Purified recombinant Human PQBP1 Protein (His tag)</p>

<p>Rabbit anti-sheep IgG (biotin) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.</p>

<p>BRRN1 antibody was raised in mouse using recombinant Human Non-Smc Condensin I Complex, Subunit H (Ncaph)</p>

<p>Spectrin antibody was raised in rabbit using highly purified spectrin from human erythrocytes as the immunogen.</p>

<p>Complete p24 sequence (231 amino acids) from HIV-1 strain HxB2 plus a 6x his tag.</p>

<p>Canine C-reactive Protein Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Canine C-reactive Protein Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Influenza A Virus IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza A Virus IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-LVINGNPITIFQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>IgM, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IgM, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Immunosuppressant; antitussive; mucolytic; expectorant</p>

<p>Mouse monoclonal Canine Heartworm antibody</p>

<p>Please enquire for more information about 1,3,4,6-Tetra-O-acetyl-2N-(4-pentynoyl)-D-mannosamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ketanserin is a 5-HT2A serotonin receptor antagonist that is used for the treatment of hypertension. This drug is also used in research to study the serotonergic system. Ketanserin has been found to also block the vesicular monoamine transporter 2.</p>

<p>Brazilein is a cationic peptide isolated from the venom of the Brazilian pit viper, Bothrops jararaca. It has been shown to activate voltage-gated sodium channels, and inhibit potassium channels. Brazilein has also been shown to bind to a variety of different receptors, including muscarinic acetylcholine (mACh) receptors and serotonin 5HT2A receptors. Brazilein is used as a research tool for investigating protein interactions, as well as various other fields in life science such as pharmacology and cell biology. Brazilein is purified with high purity and has a low molecular weight. It can be used as an inhibitor or activator depending on the requirements of the experiment.</p>

<p>The Shiga Toxin antibody is a highly reactive monoclonal antibody used in Life Sciences research. It has been extensively tested and proven to effectively detect and quantify Shiga Toxin in various samples. The antibody can be used in different assay formats, including electrochemical impedance spectroscopy, where it is immobilized on an electrode surface for sensitive detection. The Shiga Toxin antibody has also been successfully conjugated to magnetic particles for easy separation and purification of the toxin from complex matrices.</p>

<p>TM4SF4 antibody was raised using the N terminal of TM4SF4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG</p>

<p>H-HGSPAPVSTMPKRMSSE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HGSPAPVSTMPKRMSSE-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HGSPAPVSTMPKRMSSE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HGSPAPVSTMPKRMSSE-OH at the technical inquiry form on this page</p>

<p>Affinity purified Goat anti Human IgG Fc antibody</p>

<p>RSV antibody was raised in mouse using fusion protein of RSV as the immunogen.</p>

<p>Haptoglobin antibody was raised in rabbit using highly purified bovine haptoglobin as the immunogen.</p>

<p>Mezlocillin sodium (USP grade powder) chemical reference substance</p>

<p>H-QLQPFPQPELPY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QLQPFPQPELPY-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QLQPFPQPELPY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QLQPFPQPELPY-OH at the technical inquiry form on this page</p>

<p>D-dimer, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about D-dimer, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-QFKQAVYKQT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QFKQAVYKQT-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QFKQAVYKQT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QFKQAVYKQT-OH at the technical inquiry form on this page</p>

<p>H-TDSRCVIGLYHPPLQVY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TDSRCVIGLYHPPLQVY-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TDSRCVIGLYHPPLQVY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TDSRCVIGLYHPPLQVY-OH at the technical inquiry form on this page</p>

<p>Peptide H-HIATNAVLFFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>