Bioquímicos e reagentes

<p>H-AYLKTNVFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AYLKTNVFL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AYLKTNVFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AYLKTNVFL-OH at the technical inquiry form on this page</p>

<p>Peptide H-VFLENVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Phe-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It has been shown to react with amines and thiols, as well as alcohols, yielding a resin that can be used for the protection of amino acids during peptide synthesis. This product is supplied as a dry powder containing 1% DVB, 100 to 200 mesh.</p>

<p>Ac-RKAPNASDFDQW-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-RKAPNASDFDQW-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-RKAPNASDFDQW-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-RKAPNASDFDQW-NH2 at the technical inquiry form on this page</p>

<p>The beta hCG antibody is a monoclonal antibody that specifically targets and binds to human chorionic gonadotropin (hCG), a hormone produced during pregnancy. This antibody has been used in various research applications, including the study of lipoprotein lipase, insulin, trastuzumab, and other monoclonal antibodies. The beta hCG antibody can be conjugated with different labels, such as isothiocyanate, for specific detection purposes. It has also been used in studies related to growth factors like glutamate and epidermal growth factor. Additionally, this antibody has shown potential therapeutic applications in the treatment of conditions like heparin-induced thrombocytopenia.</p>

<p>H-LELLINK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LELLINK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LELLINK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LELLINK-OH at the technical inquiry form on this page</p>

<p>H-DQRVVNGGVPWPSPCPSPSS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DQRVVNGGVPWPSPCPSPSS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DQRVVNGGVPWPSPCPSPSS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DQRVVNGGVPWPSPCPSPSS-OH at the technical inquiry form on this page</p>

<p>Pseudin-2 (Ps) is one of the four pseudin peptides isolated from the skin of the paradoxical frog Pseudis-paradoxa. Pseudins are structurally related, cationic, amphipathic, a-helical anti-microbial peptides (AMP) that share sequence homology with an apoptosis regulating protein. Pseudin-2 is the most abundant and potent of the four pseudins.Pseudin-2 is active against Escherichia coli (with minimum inhibitory concentrations (MIC) of 2.5 mM), Staphylococcus aureus (MIC: 80 mM), and Candida albicans (MIC: 130 mM). Pseudin-2 also has low haemolytic activity against human erythrocytes (the concentration of Pseudin-2 producing 50% haemolysis: &gt;300 mM).In addition to its anti-microbial properties, pseudin-2 has also been shown to stimulate insulin release and may be useful as a therapy for type 2 diabetes. This peptides has a non-amidated C-terminal end, as per the naturally occurring pseudin-2.</p>

Peptide H-GVSGLNAGNAASIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Codesane (COD), is a cationic α-helical amphipathic-anti-microbial-peptide isolated from the venom of the wild bee Colletes daviesanus (Hymenoptera Colletidae). COD exhibits-anti-microbial-activity against Gram-positive and Gram-negative bacteria and Candida albicans but also noticeable haemolytic activity.COD peptide works by permeating both the outer and inner cytoplasmic membranes of Escherichia coli.</p>

<p>H-VEPQKFAEELIHRLERVQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VEPQKFAEELIHRLERVQ-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VEPQKFAEELIHRLERVQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VEPQKFAEELIHRLERVQ-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-TTWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Rotavirus antibody was raised in mouse using Intact virus of strains RRV, WA and bovine as the immunogen.</p>

<p>H-RPPSRPSRPPSHPSAHGSPA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RPPSRPSRPPSHPSAHGSPA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RPPSRPSRPPSHPSAHGSPA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RPPSRPSRPPSHPSAHGSPA-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>PAMP-12 is a peptide that can activate the human immune system. It can be used as a research tool for studying protein interactions and receptor ligand pharmacology. PAMP-12 is an inhibitor of ion channels, which are proteins that regulate the flow of ions through cell membranes. The CAS number for this peptide is 196305-05-2.</p>

<p>Portion of EBV BMLF1</p>

<p>Peptide 5TAMRA-KKRYDREFLLGFQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-NAVPITPTLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>SARS-CoV-2 Spike (757-765)</p>

<p>Histone H3 (1 - 20) K4Me3 is derived from Histone 3 (H3), which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Like the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing many lysine and arginine residues, they have a positive net charge which interacts electrostatically with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone-modifying enzymes which target histone proteins. Both processes alter the positioning of the nucleosome, allowing the DNA to be either available or inaccessible to the transcription machinery.Histone tails can undergo multiple modifications, including acetylation, methylation, ubiquitylation and sumoylation.  The modification pattern is believed to alter chromatin function/structure.  Lysine 4 of histone H3 (1 - 20) K4Me3 has been tri-methylated. This is a common cis-tail histone methylation pattern, read by histone effectors such as Spindlin1. H3 (1 - 20) K4Me3 has been used to understand interactions with histone effectors in co-crystallisation.   H3 (1 - 20) K4Me3 is labelled with the Aurora Fluor 647 fluorescent tag.</p>

<p>Peptide derived from glucosylceramidase, an enzyme found in the lysosomes which removes a glucose group from glycosphingolipid glucosylceramide during its catabolism. It functions in the endocytic pathway of membrane glycolipids and regulates influenza virus infection. Moreover it allows for the entry of other viruses into cells.Gaucher disease, the lysosomal storage disease, can be the result of mutations in the glucosylceramidase gene.The arginine residue at position 14 is isotopically labelled with carbon-13 (6) and nitrogen-15 (4).</p>

<p>Rabbit anti-sheep IgG was raised in rabbit using sheep IgG F(c) fragment as the immunogen.</p>

<p>Conjugated Testosterone 3-CMO-Alk Phos hapten</p>

<p>Purified native Human TBG protein (&gt; 95% pure)</p>

<p>Aspartyl aminopeptidase A (APA) and glutamyl APA, produce angiotensin III (Ang-III) by removing an aspartic acid from the N-terminal of angiotensin-II (Ang-II). Ang-III has many similar biological properties to Ang-II including aldosterone secretion and vasoconstriction, however some of its functions oppose those of Ang-II, such as sodium excretion and secretion of atrial natriuretic peptide (ANP). Due to its ability to promote ANP secretion Ang-III has some cardio protective effects.Ang-III likely binds to both G-protein-coupled Ang-II type 1 (AT1) and Ang-II type 2 (AT2) receptors with a similar affinity to that of Ang-II. Ang-III appears to be cleared from the plasma at a faster rate than Ang-II, therefore the physiological effects of Ang-III are likely to limited to the site at which it is produced.</p>

<p>CYP2C19 antibody was raised using the middle region of CYP2C19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD</p>

<p>Peptide H-SLDFTELDVAAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The V5 tag is derived from a small epitope (Pk) found on the P and V proteins of the paramyxovirus (of the simian virus 5 (SV5) family) and is extensively used as a general epitope tag in expression vectors.</p>

<p>[Atto655]-LifeAct (Abp140 1-17) contains the 17 amino acid peptide Lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing Lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. One application of lifeact is in the study of plant development and pathogen defence as filamentous actin within the plant's actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements. The addition of the oxazine fluorophore Atto655 which has single molecule (SM) imaging properties allows the location of the LifeAct (Abp140 1-17) to be detected.</p>

<p>Post-transmembrane region (PTM) from the envelope protein (E) of the coronavirus- Mouse Hepatitis Virus (MHV). This protein region is involved in direct membrane binding, with the C-terminal hydrophobic residues of this peptide, thought to be most relevant for membrane binding. After replication, coronaviruses (CoVs) assemble on intracellular membranes, the coronavirus envelope protein (E) is involved in virus assembly and release. E proteins have been located in the endoplasmic reticulum Golgi intermediate compartment (ERGIC) and Golgi of infected cells but are not thought to traffic to the cell surface of infected cells. CoV E is a small hydrophobic protein which is conserved between coronaviruses. E consist of a short hydrophilic amino terminal region, a hydrophobic transmembrane region and a carboxy-terminal region. CoV E protein is an integral membrane protein.E has been considered a therapeutic target for SARS-CoV-2.</p>

<p>VP4 is a viral coat protein of Nora virus encoded for by ORF4. The product of these gene is likely cleaved into three capsid proteins, VP4A, B and C. VP4 is also the most conserved gene from Nora virus and related viruses. Nora virus is a non-pathogenic virus found in gut of Drosophila melanogaster. It causes persistent, non-pathological infection, it replicates in the fly gut and is transmitted via the faecal-oral route. Nora virus has a 12333 nucleotides long single-stranded RNA genome of positive polarity.</p>

<p>Granzyme B antibody was raised in mouse using recombinant granzyme B as the immunogen.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are fundamental in compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4's lysine rich tail plays a role in the higher order chromatin folding.Modifications allow histones to contribute to gene regulation, chromosome condensation and DNA repair. In yeast, methylation of R3 of Histone 4 results in the recruitment of histone acetyl transferase to the chromatin and the acetylation of Histone 4 K5.</p>

<p>Yellow Fever Virus Envelope Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Yellow Fever Virus Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Monoamine oxidase-B inhibitor; anti-parkinsonian; neuroprotective</p>

<p>RAG8 is a pepducin- a cell-penetrating palmitoylated peptide with a C-terminal NH2.- Palmitoyl is a 16-carbon aliphatic chain which enhances the hydrophobicity of the peptide, and therefore improves its penetration through lipid structures.The peptide sequence corresponds to a key regulatory sequence at the intracellular C-terminus of PAR4. This motif regulates calcium signalling and PAR4 interactions with the signalling protein-β-arrestin. RAG8 is a PAR4 antagonist that can attenuate calcium signalling and β-arrestin-1 and 2 recruitment to PAR4 which has been activated with the PAR4 agonist AYPGKF-NH2.Disrupting this PAR4/β-arrestin signalling pathway with RAG8 blocks PAR4 dependent platelet activation and reduces stability of blood clots.</p>

<p>Ac-DPGANAAAAKIQASFR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-DPGANAAAAKIQASFR-NH2 is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-DPGANAAAAKIQASFR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-DPGANAAAAKIQASFR-NH2 at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Neuropeptide and hormone involved in many processes, including- social bonding--sexual reproduction- childbirth and breastfeeding. Oxytocin is synthesised in the hypothalamus as a prepropeptide consisting of a signal peptide, the oxytocin peptide hormone, a processing signal and the carrier protein- neurophysin. The prohormone then undergoes endoproteolytic cleavage and amidation to form the final oxytocin peptide.Dysregulation of oxytocin has been implicated in the pathophysiology of neuropsychiatric disorders that impact social functioning, such as autism, schizophrenia, and depression as well as anorexia nervosa. Intranasal oxytocin administration may reduce amygdala activity and amygdala-midbrain connectivity in response to fearful situations- reduce cortisol release and anxiety in response to psychosocial stress- increase trust behaviour- increase the ability to interpret mental states, and increase the amount of time spent gazing at the eyes when viewing faces.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Cellulose synthase is a crucial enzyme involved in the synthesis of cellulose. Cellulose is an aggregation of unbranched polymer chains made of β-(1-4)-linked glucose residues, and is a component of primary and secondary cell walls - functioning to primarily maintain strength and shape in cells. Cellulose is synthesised by large cellulose synthase complexes (CSCs), which consist of synthase protein isoforms (CesA) that are arranged into a unique hexagonal structure. Cellulose synthase Light [Populus tomentosa] is specific to the Populus tomentosa species.</p>

<p>Peptide Aoa-KEAHFSSLQQRCCNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-SGPPGLQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Desmoglein 2 antibody was raised in rabbit using recombinant peptide (extracellular repeat domain E2 of human Desmoglein 2) as the immunogen.

<p>The cyclic pentapeptide cyclo(Arg-Gly-Asp-[D-Phe]-Lys) is a highly potent and selective inhibitor for the alphavβ3 integrin receptor. A related compound, cyclo(Arg-Gly-Asp-[D-Phe]-Val), is a promising anticancer drug candidate- it inhibits angiogenesis and induces apoptosis in vascular cells.Cyclic RGD-containing peptides are selective antagonists of integrins, proteins that play important roles in cell-cell and cell-matrix interactions. In a suitably labelled form, these peptides may serve as useful tools for diagnostic imaging and peptide targeted therapy of some types of cancer.</p>

<p>Factor Vlll antibody was raised in mouse using purified human factor VIII as the immunogen.</p>

Pioglitazone is a thiazolidinedione drug that is used in combination with diet change and exercise to treat glycemic levels in patients with type 2 diabetes mellitus. This drug is an agonist of peroxisome proliferator-activated receptor-gamma and increases glucose uptake. In animal studies, Pioglitazone has shown to have anti-inflammatory properties.