Bioquímicos e reagentes
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(98.859 produtos)
- Por Alvo Biológico(100.588 produtos)
- Por uso/Efeitos Farmacológicos(6.818 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(348 produtos)
- Biologia Vegetal(6.847 produtos)
- Metabólitos secundários(14.353 produtos)
Foram encontrados 130633 produtos de "Bioquímicos e reagentes"
GSK3 beta protein
GSK3 beta protein is a target molecule in the field of Life Sciences. It belongs to the family of lectins, which are proteins that bind to specific carbohydrates. GSK3 beta protein has been studied extensively for its role in various biological processes, including cell signaling and regulation of gene expression. It has been shown to interact with a wide range of proteins and antigens, including interferon and metal-binding proteins.Pureza:Min. 95%SMAD4 antibody
The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.
Mouse Prolactin ELISA kit
ELISA Kit for detection of Prolactin in the research laboratory
Pureza:Min. 95%HCG beta Antibody
The HCG beta Antibody is a specific monoclonal antibody that is commonly used in Life Sciences research. It has been extensively studied and proven to be highly effective in various applications. This antibody specifically targets the influenza hemagglutinin, which plays a crucial role in receptor binding and viral entry.
Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
NSUN2 antibody
NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP
D-dimer antibody
D-dimer antibody is a monoclonal antibody that specifically targets D-dimer, a protein fragment that is produced when blood clots are broken down. This antibody has antiviral properties and can neutralize the activity of D-dimer, preventing excessive blood clot formation. In addition to its therapeutic use, this antibody is also used in research and diagnostics in the field of Life Sciences. It can be used to study the role of D-dimer in various biological processes, such as wound healing and thrombosis. The formulation of this antibody includes excipients like histidine and insulin to ensure stability and enhance its efficacy.Human Leptin ELISA Kit
Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.
Pureza:Min. 95%GTPBP10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP10 antibody, catalog no. 70R-2020
Pureza:Min. 95%PNMA3 antibody
PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM
RARA antibody
The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.
LIX protein (Mouse)
Region of LIX protein corresponding to amino acids APSSVIAATE LRCVCLTVTP KINPKLIANL EVIPAGPQCP TVEVIAKLKN QKEVCLDPEA PVIKKIIIQK ILGSDKKKAK RNALAVERTA SVQ.
Pureza:Min. 95%PAGE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PAGE1 antibody, catalog no. 70R-1637
Pureza:Min. 95%
