Ácidos carboxílicos

<p>4-Fluorobenzoic acid is a chemical compound with the molecular formula C6H4FO2 and is a member of the group of chemicals known as carboxylic acids. It has been shown to have high levels of antibacterial activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). 4-Fluorobenzoic acid can be used for wastewater treatment and also has the potential to be used in other applications such as an antimicrobial agent or an additive in food packaging. The mechanism of its antibacterial activity is not well understood but may be related to its ability to inhibit the enzyme diphenolase, which catalyzes the conversion of phenols into quinones.</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>

<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of sitagliptin</p>

<p>Mercaptoacetic acid sodium salt (MAS) is an oxidation catalyst that is used to convert ethyl alcohol into acetic acid. It has been shown to be a good catalyst for the oxidation of hydroxyl groups in the presence of metal hydroxides or inorganic acids, such as sodium carbonate. MAS has also been shown to be toxic to human serum and is not recommended for use in humans. The toxicity of MAS may be due to its ability to react with fatty acids and form mercaptans, which are volatile compounds that can cause irritation. Mercaptoacetic acid sodium salt reacts with potassium dichromate and forms mercaptans and other products, which may contribute to its toxicity.</p>

<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tetrabutylammonium acetate is a complex of tetrabutylammonium with the trifluoroacetate anion. It has been used as a reagent for the preparation of α-hydroxylated ketones, including natural products. Tetrabutylammonium acetate can be used in titration calorimetry to measure the heat evolved during the reaction between hydroxyl group and sodium salts. The heat released corresponds to the amount of water produced from this reaction. In this way, it can be determined whether or not a molecule contains an active hydrogen atom. Tetrabutylammonium acetate also reacts with reactive compounds such as dpp-iv inhibitors, forming a reactive intermediate that cannot be isolated due to its instability. This intermediate is detected by analytical methods such as plasma mass spectrometry or infrared spectroscopy. Tetrabutylammonium acetate also reacts with asymmetric synthesis, forming an intram</p>

<p>Silver trifluoroacetate is a chemical compound that is a silver salt of trifluoroacetic acid. Silver trifluoroacetate is a white crystalline solid, soluble in water and alcohols, but insoluble in ethers. It has the chemical formula AgCF3CO2H. The crystal structure of silver trifluoroacetate has been determined by x-ray diffraction techniques and found to be orthorhombic with space group Pbam. The molecule consists of two 5-membered heteroaromatic rings, one containing carbon atoms and the other containing nitrogen atoms. The nitrogen atom is bonded to six hydrogen atoms and three fluorine atoms, while the carbon atom is bonded to four oxygen atoms and one fluorine atom. Synthesis methods for this compound include reacting silver nitrate with sodium carbonate in water vapor at 120°C.</p>

<p>Mercuric acetate is a salt of mercuric and acetic acid. It is used as an antiseptic, disinfectant, and preservative in the food industry. Mercuric acetate has been shown to have anti-inflammatory properties and is used for the treatment of inflammatory bowel disease. The ester linkage between the two molecules allows it to be hydrolysed into its components by enzymes such as esterases or glucuronidases, which may be one of the reasons for its therapeutic effects. Mercuric acetate also reacts with biological molecules, including proteins, nucleic acids, and carbohydrates. This reaction mechanism may contribute to its other biological properties such as lowering blood sugar levels and inhibiting glycolysis in cells that depend on sodium-dependent glucose transport mechanisms.</p>

<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>

<p>Methyl benzofuran-6-carboxylate is a synthetic retinoid that is a conformationally constrained analogue of retinoic acid, which is one of the most powerful biological molecules. Methyl benzofuran-6-carboxylate has been shown to be an effective anti-inflammatory agent and may be useful in the treatment of inflammatory skin diseases. It also inhibits the production of proinflammatory cytokines and chemokines, such as TNF-α, IL-1β, IL-8, CCL2, CXCL1, and CXCL2. Methyl benzofuran-6-carboxylate binds to specific receptors on cell surfaces to inhibit the production of inflammatory mediators. The drug also has been shown to have antiangiogenic activity. This property may be due to its ability to inhibit the production of vascular endothelial growth factor (VEGF) and other angiogenic factors.</p>

<p>BAM-22P (8-22) trifluoroacetate salt is a compound that has been shown to be an effective drug for the treatment of pain. It has been shown to have an effect on bone cancer, which can be activated by serotonin. This compound may be beneficial in treating nerve injury and fibrosarcoma cells. BAM-22P (8-22) trifluoroacetate salt is an allosteric modulator of the serotonin receptor and may be used as a treatment for pain in wild-type mice. The molecule is also a serotonin reuptake inhibitor, which prevents the reuptake of serotonin into the presynaptic neuron. This leads to increased levels of serotonin in the synapse and increased pain relief.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>

<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about s-2-(4-Aminobenyl)-diethylenetriamine penta-tert-butyl acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,3,6,8-Pyrenetetrasulfonic acid tetrasodium salt (PTS) is a palladium complex that is used as a catalyst in the chemical industry. It can be prepared by the reaction of palladium chloride with sodium sulfide and sodium hydroxide. PTS has been shown to react with diethyl succinate, forming a solid catalyst that can be stored for longer periods of time. This compound has been found to catalyze hydrogenations under constant pressure conditions and also exhibit low energy consumption when performing reactions. PTS is able to bind to DNA, leading to cancer cell death. PTS also has fluorescence properties and can be used in electrochemical impedance spectroscopy.</p>

<p>Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt is a peptidomimetic with peroxidase activity. It has the ability to bind to red blood cells and monoclonal antibodies, which are used in spatially specific immunoassays. Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt also has an effect on hyperresponsiveness and can be used as a costimulatory antigen for cancer immunotherapy.</p>

<p>Please enquire for more information about (Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-His-Arg-Pro-OH acetate salt is a synthetic monoclonal antibody that binds to fibrinogen. It has been used in the production of a model protein and as an anticoagulant. H-Gly-His-Arg-Pro-OH acetate salt has been shown to inhibit the growth of tissue plasminogen activator, which is a growth factor for cells involved in blood clotting. This drug also inhibits the release of acetylcholine from nerve cells, which may be due to its ability to bind to plasma proteins.</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (25-35) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Please enquire for more information about PYX-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt is a potent inhibitor of the enzyme kallikrein, which is involved in the production of kinins. It has been shown to inhibit bradykinin breakdown by inhibiting kallikrein and thus prolonging the effects of this hormone. Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt also inhibits aldosterone levels in plasma and reduces glucocorticoid levels, which may be due to its ability to inhibit plasma renin concentrations.</p>

<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>

<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>