Anticorpos primários

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>Rabbit polyclonal Cytokeratin 18 antibody (Ser52)</p>

<p>Rabbit polyclonal TROVE2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL</p>

<p>The PDCD4 antibody is a highly specialized antibody that targets the protein phosphatase 2A (PP2A), which plays a crucial role in regulating cellular processes such as cell growth, proliferation, and apoptosis. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.</p>

<p>B4GALNT3 antibody was raised using the N terminal of B4GALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA</p>

<p>Purified Rabbit polyclonal NFKBID antibody</p>

<p>The p53 antibody is a protein that specifically targets and binds to the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Infectious bronchitis virus (IBVD) is an acute, highly contagious upper respiratory tract disease in chickens</p>

<p>ATG9A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV</p>

<p>ZNF317 antibody was raised in rabbit using the C terminal of ZNF317 as the immunogen</p>

<p>Rabbit polyclonal SRGAP3 antibody</p>

<p>Rabbit polyclonal LAMB1 antibody</p>

<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>Rabbit polyclonal PRKAG1 antibody</p>

<p>Purified Polyclonal IL37 antibody</p>

<p>DHRS2 antibody was raised in Rabbit using Human DHRS2 as the immunogen</p>

<p>Ppp2r2d antibody was raised in rabbit using the C terminal of Ppp2r2d as the immunogen</p>

<p>ETR3 antibody was raised in rabbit using C terminal sequence [VQLKRSKNDSKPYC] of human and mouse ETR-3 as the immunogen.</p>

<p>The ITCH antibody is a powerful tool in the field of immunology and cancer research. It is a polyclonal antibody that specifically targets the ITCH protein, which plays a crucial role in various cellular processes. The ITCH antibody has been extensively studied for its ability to inhibit the activity of carbonyl reductase, an enzyme involved in drug metabolism.</p>

<p>The CD298 antibody is a highly specific monoclonal antibody that targets DNA-binding proteins. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody binds specifically to the surface glycoprotein CD298, forming a specific complex that can be detected using techniques such as electrochemical impedance spectroscopy. The CD298 antibody has been shown to have high affinity and specificity for its target, making it a valuable tool for studying the function and localization of DNA-binding proteins in various biological systems. Additionally, this antibody has been used in studies investigating the role of CD298 in processes such as glutamate signaling and proteolytic activity. With its versatility and reliability, the CD298 antibody is an essential tool for researchers working in the field of DNA-binding proteins.</p>

<p>FBXO31 antibody was raised in rabbit using the middle region of FBXO31 as the immunogen</p>

<p>Rabbit Polyclonal MARK1 antibody (Thr215)</p>

<p>Rabbit Polyclonal ATF4 antibody (Ser245)</p>