Anticorpos primários

<p>Rabbit polyclonal UBR1 antibody</p>

<p>Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>Rabbit polyclonal AN32C antibody</p>

<p>Rabbit polyclonal SREBP1 antibody (Ser439)</p>

<p>The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.</p>

<p>Purified Polyclonal AMPK beta 1 antibody</p>

<p>PPM1M antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL</p>

<p>FMNL1 antibody was raised in mouse using recombinant Human Formin-Like 1</p>

<p>The ATF2 antibody is a highly specialized monoclonal antibody that plays a crucial role in neutralizing ATF2, a key protein involved in various cellular processes. This antibody specifically targets the disulfide bond present in ATF2, preventing its interaction with other molecules and disrupting its normal function.</p>

<p>Purified Rabbit polyclonal NFKBID antibody</p>

<p>SLC25A46 antibody was raised using the C terminal of SLC25A46 corresponding to a region with amino acids  LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH</p>

<p>POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC</p>

<p>Purified Rabbit polyclonal OR89 antibody</p>

<p>Rabbit Polyclonal eIF2 alpha antibody (Ser49)</p>

<p>Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF</p>

<p>The FANCA antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to target and bind to the FANCA protein, which is involved in various cellular processes such as insulin-like growth factor signaling and DNA repair. This antibody has been extensively studied and proven to be effective in research related to trastuzumab, alpha-synuclein, and other proteins.</p>

<p>FBXO31 antibody was raised in rabbit using the middle region of FBXO31 as the immunogen</p>

<p>Rabbit polyclonal LRP2 antibody</p>

<p>The FOXO4 antibody is a monoclonal antibody that specifically targets the protease FOXO4. This protease plays a crucial role in extracellular processes and has been implicated in various diseases. The FOXO4 antibody binds to the protease, inhibiting its activity and preventing it from carrying out its normal functions.</p>

<p>ZBTB40 antibody was raised in rabbit using the N terminal of ZBTB40 as the immunogen</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>Purified Polyclonal HKR1 antibody</p>

<p>Rabbit polyclonal TPD54 antibody</p>

<p>Rabbit polyclonal TFDP1 antibody</p>

<p>Rabbit polyclonal NFKP p105/p50 antibody (Ser932)</p>