Anticorpos primários

<p>Rabbit polyclonal PKC epsilon antibody (Ser729)</p>

<p>The POT1 antibody is a growth factor that belongs to the class of Polyclonal Antibodies. It forms dimers with calmodulin and has cytotoxic properties. This antibody is widely used in Life Sciences research, particularly in studies related to epidermal growth factor. It can be used as a monoclonal antibody or in combination with other antibodies. The POT1 antibody has neutralizing effects on human serum and has been shown to inhibit the activity of electrode and gm-csf colony-stimulating factor. Furthermore, it has been found to have potential therapeutic applications in the treatment of autoimmune diseases associated with autoantibodies.</p>

<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA</p>

<p>ATP1B1 antibody was raised using the N terminal of ATP1B1 corresponding to a region with amino acids RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD</p>

<p>Rabbit polyclonal NDUFA3 antibody</p>

<p>Rabbit polyclonal Spermidine synthase antibody (HRP)</p>

<p>Aquaporin 5 antibody is a polyclonal antibody that specifically targets the Aquaporin 5 protein. Aquaporins are a family of integral membrane proteins that facilitate the transport of water across cell membranes. Aquaporin 5 is primarily found in the salivary glands, lungs, and lacrimal glands, where it plays a crucial role in regulating fluid secretion.</p>

<p>Mouse monoclonal DFFA antibody</p>

<p>ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL</p>

<p>Desmin antibody is a monoclonal antibody that specifically targets desmin, a protein found in muscle cells. This antibody is widely used in life sciences research to study the structure and function of muscle tissues. Desmin antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. It has been shown to effectively detect desmin in different cell types, including MCF-7 cells. Additionally, this antibody has been used in studies investigating the role of desmin in various cellular processes, such as cell growth and differentiation. Its high specificity and sensitivity make it a valuable tool for researchers studying muscle-related disorders or exploring potential therapeutic targets.</p>

<p>Purified Polyclonal PIAS3 antibody</p>

<p>Rabbit Polyclonal Tsc2 antibody (Ser939)</p>

<p>ST14 antibody is a monoclonal antibody that targets protein kinase ST14. It is widely used in Life Sciences research for its ability to specifically bind to ST14 and inhibit its activity. This antibody has been shown to effectively block the function of ST14, preventing its interaction with other proteins and interfering with various cellular processes. Additionally, ST14 antibody has been used in studies involving albumin, inhibitors, antibodies, tyrosine, alpha-synuclein, activated mitogen-activated protein (MAP) kinases, collagen, and glucose transporter. It is also known to enhance the cytotoxic effects of certain anti-CD20 antibodies. With its high specificity and potency, ST14 antibody is a valuable tool for scientists studying protein kinase signaling pathways and their role in disease development and progression.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Purified Polyclonal AMPK alpha 1 antibody</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>Purified Polyclonal ARF4 antibody</p>

<p>Rabbit polyclonal NFKB p100 antibody</p>

<p>PPA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal OR8K1 antibody</p>

<p>The Tuberin antibody is a highly specialized protein complex used in Life Sciences research. It is an essential tool for studying various biomolecules and their interactions. This antibody specifically targets tuberin, a protein involved in the regulation of cell growth and proliferation. By binding to tuberin, this antibody can help researchers understand the mechanisms behind diseases such as cancer and neurological disorders.</p>

<p>ICA1L antibody was raised using the middle region of ICA1L corresponding to a region with amino acids PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>Rabbit polyclonal KCNMB2 antibody</p>

<p>SET 7/9 antibody was raised in mouse using recombinant human SET7/9 (1-366aa) purified from E. coli as the immunogen.</p>