Anticorpos primários

<p>Purified Rabbit polyclonal OSGEPL1 antibody</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>CDC2 antibody was raised using the middle region of Cdc2 corresponding to a region with amino acids DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP</p>

<p>IKK-gamma antibody was raised in rabbit using residues 2-13 [NRHLWKSQLCEM] of the IKK-gamma protein as the immunogen.</p>

<p>LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT</p>

<p>C1ORF96 antibody was raised using the N terminal Of C1Orf96 corresponding to a region with amino acids LGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPP</p>

<p>TBL1Y antibody was raised in rabbit using the middle region of TBL1Y as the immunogen</p>

<p>Arsb antibody was raised in rabbit using the middle region of Arsb as the immunogen</p>

<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA</p>

<p>The AML1 antibody is a neutralizing insulin antibody that targets the growth factor adalimumab. It is a monoclonal antibody that specifically binds to glutamate and has been extensively studied in the field of Life Sciences. This antibody is commonly used in research for its ability to detect and measure various proteins, including rubisco, insulin, TNF-α, natriuretic peptides, and glycoproteins. With its high specificity and sensitivity, the AML1 antibody is an essential tool for scientists conducting experiments related to protein analysis and characterization.</p>

<p>OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA</p>

<p>Rabbit polyclonal CRP antibody (Prediluted for IHC)</p>

<p>PON1 antibody was raised using the middle region of PON1 corresponding to a region with amino acids VVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF</p>

<p>POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ</p>

<p>Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ</p>

<p>TACI antibody was raised in goat using highly pure recombinant human TACI as the immunogen.</p>

<p>UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL</p>

<p>Purified Mouse anti-Cat IgE Antibody</p>

<p>HMBS antibody was raised using the middle region of HMBS corresponding to a region with amino acids SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR</p>

<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>

<p>KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP</p>

<p>Purified Rabbit polyclonal OR2F2 antibody</p>

<p>Progesterone 11 alpha Monoclonal Antibody</p>

<p>The Leptin Receptor antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the leptin receptor in human serum. Leptin receptor plays a crucial role in regulating various physiological processes such as metabolism, appetite, and energy balance. This antibody specifically binds to the leptin receptor and inhibits its activity, thereby modulating the signaling pathways associated with it.</p>

<p>The FOS antibody is a glycoprotein that belongs to the family of epidermal growth factor (EGF)-like antibodies. It contains sugar moieties that enhance its stability and functionality. This antibody has been shown to have endonuclease activity, which allows it to cleave DNA at specific sites. Additionally, it exhibits glutamate and hyaluronidase activity, making it useful in various biochemical assays. The FOS antibody can also be pegylated to increase its half-life and improve its pharmacokinetic properties. In life sciences research, this antibody is commonly used for immunostaining and Western blotting experiments. Its high specificity and affinity make it an excellent tool for studying protein expression patterns and understanding cellular signaling pathways. Furthermore, the FOS antibody has been shown to inhibit microvessel density and collagen synthesis, suggesting potential therapeutic applications in angiogenesis-related disorders. Its ability to modulate TGF-beta signaling further expands its potential use in cancer research and tissue engineering studies.</p>

<p>The mGLUR5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting the androgen receptor and exerting cytotoxic effects on specific cells. This antibody also has the ability to neutralize certain growth factors, interferons, hepatocyte growth factors, and chemokines. Additionally, it exhibits antiviral properties by targeting glycoproteins involved in viral replication. The mGLUR5 antibody is a versatile tool that can be utilized in various research applications, including multidrug resistance studies and electrode-based assays. Its high specificity and potency make it an invaluable asset for scientists working in diverse fields of study.</p>