Anticorpos primários

The LXN antibody is a monoclonal antibody that is used to detect and study angiogenic factors. It can be used in various research applications, including immunohistochemistry and Western blotting. The LXN antibody specifically recognizes and binds to a target protein, allowing for the detection and analysis of its expression levels. This antibody has been shown to inhibit syncytia formation and block the activity of certain growth factors. Additionally, it has been found to have cholinergic activity and can modulate the function of nucleotide molecules. The LXN antibody is available as a ready-to-use solution and can be easily incorporated into experimental protocols.

Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

INTS5 antibody was raised in Rabbit using Human INTS5 as the immunogen

Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.

Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen

Rabbit polyclonal TMEM141 antibody

PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT

Rabbit polyclonal PP2A antibody (FITC)

KRT17 antibody was raised in Rabbit using Human KRT17 as the immunogen

Mouse monoclonal GSTT2 antibody

The RAB32 antibody is a monoclonal antibody that targets the RAB32 protein. This protein plays a crucial role in various cellular processes, including the regulation of superoxide production and growth factor signaling. The RAB32 antibody has been shown to effectively neutralize the activity of RAB32, making it a valuable tool for researchers in the field of Life Sciences.

Mouse monoclonal PGAM2 antibody

The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.

MCM4 antibody was raised in Rabbit using Human MCM4 as the immunogen

Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2)  polyclonal Antibody

Rabbit polyclonal HDAC5 antibody (Ser498)

NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Rabbit polyclonal Cytidine deaminase antibody (HRP)

HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS

Mouse monoclonal KIAA0495 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.

The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.

Rabbit Polyclonal Synaptotagmin II antibody (Thr202)

Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen

The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.