Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.793 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(736 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75326 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
PGAM2 antibody
<p>PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDT</p>PSCA antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>FkBP4 antibody
<p>FkBP4 antibody was raised in mouse using recombinant human FkBP4 (1-459aa) purified from E. coli as the immunogen.</p>EIF5A2 antibody
<p>EIF5A2 antibody was raised using the N terminal of EIF5A2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK</p>EIF4G3 antibody
<p>EIF4G3 antibody was raised using the N terminal of EIF4G3 corresponding to a region with amino acids TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIA</p>hnRNP L Antibody
<p>The hnRNP L Antibody is a highly specific monoclonal antibody that is widely used in life sciences research. This cytotoxic antibody targets hnRNP L, a nuclear protein involved in various cellular processes such as RNA splicing, transport, and stability. The hnRNP L Antibody has been extensively validated for use in assays such as immunofluorescence, immunohistochemistry, and western blotting. It provides reliable and reproducible results, making it an essential tool for researchers studying the role of hnRNP L in gene expression regulation and other molecular mechanisms. With its high affinity and specificity, this monoclonal antibody offers exceptional sensitivity and accuracy in detecting hnRNP L in various biological samples. Whether you are investigating myostatin signaling pathways or exploring the functions of fibrinogen or lipoprotein lipase, the hnRNP L Antibody is an indispensable tool for your research needs. Trust this reliable antibody to provide accurate and consistent results that will advance your</p>
