Anticorpos primários

Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen

Rabbit polyclonal POLM antibody

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

Rabbit polyclonal PDCL2 antibody

FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

ASAHL antibody was raised using the middle region of Asahl corresponding to a region with amino acids VSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNR

Rabbit polyclonal IP6K3 antibody

The PCIP antibody is a highly specialized monoclonal antibody that targets the fas-mediated apoptosis pathway. It has been extensively studied in adipose tissue and has shown cytotoxic effects on cells expressing high levels of interleukin-6 (IL-6) and growth factor receptors. This monoclonal antibody specifically binds to β-catenin, a key protein involved in cell signaling and regulation of gene expression. It has also been shown to interact with other monoclonal antibodies targeting collagen, erythropoietin, fibrinogen, and phosphatase. The PCIP antibody disrupts the organization of actin filaments within cells, leading to apoptosis and inhibition of cell growth.

NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP

Rabbit polyclonal COX5A antibody (FITC)

MYST2 antibody was raised in Rabbit using Human MYST2 as the immunogen

The STAT3 antibody is a highly effective tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets the STAT3 protein, which plays a crucial role in various cellular processes such as growth factor signaling and actin filament formation. By binding to STAT3, this antibody allows researchers to study its activation and function.

INTS5 antibody was raised in Rabbit using Human INTS5 as the immunogen

MEPE antibody was raised in rabbit using the middle region of MEPE as the immunogen

NIP7 antibody was raised in Rabbit using Human NIP7 as the immunogen

EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT

Rabbit polyclonal AP2S1 antibody (FITC)

GRIP1 antibody was raised in rabbit using the C terminal of GRIP1 as the immunogen

Purified Rabbit polyclonal PR4b antibody

NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

Rabbit polyclonal SEC11A antibody

Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.

FECH antibody was raised in Rabbit using Human FECH as the immunogen

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.

The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.

Rabbit polyclonal QRSL1 antibody

RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL

Rabbit polyclonal TSR2 antibody

Rabbit polyclonal RNASEH1 antibody

Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.

WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR

RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

AK1 antibody was raised in Rabbit using Human AK1 as the immunogen

alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.

Purified Polyclonal ADRB2 antibody

HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.

GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.

Purified Rabbit polyclonal Chk1 antibody (Ser296)

Rabbit polyclonal Aquaporin 2 antibody (Ser256)

The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.

PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen

Purified Rabbit polyclonal RACK1A antibody

PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen