Anticorpos primários

<p>PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG</p>

<p>LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV</p>

<p>The MEF2A antibody is a highly specialized antibody that targets dopamine and TNF-α receptors. It is available in both polyclonal and monoclonal forms, making it suitable for various research applications. This antibody has been extensively tested in human serum samples and has shown high specificity and sensitivity. It can be used to detect autoantibodies, interferon levels, and other markers of immune response. Additionally, the MEF2A antibody has been used in studies involving leukemia inhibitory factor (LIF) and adalimumab, demonstrating its versatility in different experimental settings. With its anticoagulant properties and ability to inhibit family kinase activity, this antibody is an invaluable tool for researchers in the life sciences field.</p>

<p>CASR antibody was raised in Rabbit using Human CASR as the immunogen</p>

<p>Rabbit polyclonal OSR1 antibody (Thr185)</p>

<p>The PAK7 antibody is a highly specialized protein that plays a crucial role in various cellular processes. This monoclonal antibody has the ability to neutralize and immobilize PAK7 dimers, which are important for cell growth and survival. By targeting PAK7, this antibody can effectively inhibit its cytotoxic effects and prevent the activation of downstream signaling pathways.</p>

<p>ST14 antibody is a monoclonal antibody that targets protein kinase ST14. It is widely used in Life Sciences research for its ability to specifically bind to ST14 and inhibit its activity. This antibody has been shown to effectively block the function of ST14, preventing its interaction with other proteins and interfering with various cellular processes. Additionally, ST14 antibody has been used in studies involving albumin, inhibitors, antibodies, tyrosine, alpha-synuclein, activated mitogen-activated protein (MAP) kinases, collagen, and glucose transporter. It is also known to enhance the cytotoxic effects of certain anti-CD20 antibodies. With its high specificity and potency, ST14 antibody is a valuable tool for scientists studying protein kinase signaling pathways and their role in disease development and progression.</p>

<p>Rabbit polyclonal RPC3 antibody</p>

<p>MDH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS</p>

<p>Purified Rabbit polyclonal ERF antibody (Thr526)</p>

<p>KCNV1 antibody was raised using the N terminal of KCNV1 corresponding to a region with amino acids ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP</p>

<p>The PDK1 antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It specifically targets alpha-fetoprotein, a protein that is expressed in various tissues including cardiomyocytes. The PDK1 antibody has been shown to have neutralizing effects on chemokines, which play a crucial role in inflammation and immune response. This antibody can be used as a research tool to study the function and regulation of chemokines in different biological processes. Additionally, the PDK1 antibody has been found to inhibit the activity of β-catenin, an important signaling molecule involved in cell proliferation and differentiation. This inhibition can have implications for cancer research and therapeutics development. The PDK1 antibody is produced using advanced techniques in monoclonal antibody production and undergoes rigorous quality control to ensure its efficacy and specificity. It is formulated with excipients that maintain its stability and functionality.</p>

<p>Fank1 antibody was raised in rabbit using the middle region of Fank1 as the immunogen</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL</p>

<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>

<p>ARID5A antibody was raised in rabbit using the N terminal of ARID5A as the immunogen</p>

<p>Rabbit polyclonal HKR1 antibody</p>

<p>ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA</p>

<p>IgG2a Negative Control Monoclonal Antibody</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Progesterone 11 alpha Monoclonal Antibody</p>

<p>C13ORF7 antibody was raised using the N terminal Of C13Orf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG</p>

<p>PDK1 antibody was raised using the middle region of PDK1 corresponding to a region with amino acids ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY</p>